SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|139452|e_gw1.136.98.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|139452|e_gw1.136.98.1
Domain Number 1 Region: 21-272
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-88
Family Calponin-homology domain, CH-domain 0.00000273
Further Details:      
 
Domain Number 2 Region: 292-409
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-32
Family Spectrin repeat 0.0000891
Further Details:      
 
Domain Number 3 Region: 589-729
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-31
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 4 Region: 1220-1373
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-30
Family Spectrin repeat 0.00028
Further Details:      
 
Domain Number 5 Region: 1486-1586
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-29
Family Spectrin repeat 0.00012
Further Details:      
 
Domain Number 6 Region: 1008-1162
Classification Level Classification E-value
Superfamily Spectrin repeat 4.58e-28
Family Spectrin repeat 0.000048
Further Details:      
 
Domain Number 7 Region: 2144-2254
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-27
Family Pleckstrin-homology domain (PH domain) 0.00012
Further Details:      
 
Domain Number 8 Region: 691-811
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-26
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 9 Region: 901-1041
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-26
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 10 Region: 1645-1799
Classification Level Classification E-value
Superfamily Spectrin repeat 2.32e-25
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 11 Region: 812-947
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-24
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 12 Region: 1857-2012
Classification Level Classification E-value
Superfamily Spectrin repeat 2.54e-24
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 13 Region: 419-518
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-22
Family Spectrin repeat 0.0003
Further Details:      
 
Domain Number 14 Region: 521-632
Classification Level Classification E-value
Superfamily Spectrin repeat 4.14e-19
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 15 Region: 1352-1481
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-16
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 16 Region: 1999-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000017
Family Spectrin repeat 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|139452|e_gw1.136.98.1
Sequence length 2290
Sequence
MTEIENYNNGGIRWDPGQVDDDFDAGNNSSRLFERSRIKALADERENVQKKTFQKWVNSH
LVRVGCKISDLYVDLRDGKMLMKLLEVLSGERLPRPTKGKMRIHCLENVDKALGFLHEQR
VHLENMGAHDIVDGSSRLTLGLIWTIILRFQIQDITFEESENSETKSAKDALLLWCQMKT
AGYPNVNVRNFTSSWRDGLAFNALIHKHRPDLIQYEKLQKSNAIHNLNNAFTVAEDKLGL
TPLLDAEDVNVDFPDEKSIITYVVTYYHYFSKMKADSVQGKRIGKVIDGCIDSENTVHEY
ESLTSDLLEWIEQTIVILNDRQYANSLTGVQQQLAAFNTYRIVEKPPKFDEKGNLEVLLF
TIQSQMRANNQRPYLPKEGKMVSDINKAWERLEHAEHERELSLREELIRQEKLEQLAARF
DRKAGMRETWLSENQRLVSQDNFGSDLAAVEAATKKHEAIETDINAYEERVQAVIAVASE
LEHENYHDIVRINARKDNVLRLWNYLLELLRARRMRLEFTLSLQKVFQEMLYILDWMGEI
KSRLLSEDYGKHLMGVEDLLQIHSLLEADVHVVGERVKTVNGMAERYVNDDIPELSGYHP
CDPEMVRDRMSTLQSAYEELEQLAKDRRERLEESRKLWQFYWDMADEEGWIKEKEQLMSS
PELGHDLTSVSLLLSKHKAIEDEMTARHSHLKSVTQVGDDLIGADNFGADKIKQRIDEID
QQWESLIDLAAYRKKRLLEAVDFYQFFADADDVDTWMLDILRMVSSEDVGKDEASVQSLL
KKHKEVTEELKSYHTSIEALHEQAASLGEQDRESADVQSRLGSIDKRYQELLELAKLRKQ
RLLDALSLYKLANEADGVETWIDEKEKFLTTITMTDDIEELAIMKHRFDSYEHEMNSTAS
KVAVVNQLARQLLTVEHPNAEDVIGRQNQLNQRWNNLREHVDQKRDEINLSHGLQNFHIE
CNETISWINEKAKIIESTEDLGNDLTGVMTLQRRLSGMERDLAAIEAKLESLQAEADMLQ
EEKPEEAAAIKEKIAEINNVWMDLKEMLKERDEKLGEASELQHFLGSLDHFQQWLSRTQT
TIASEDTPNSLAEAEKLLNQHQQIKDEIDAYAPEYAKIKAYGDKETEGQTDPQHMFLAQR
LQALDDGWHELLQMWENRQQHLSQSLNYQIFLRDAKQAEVLLNQQENFLSKEDVPNSVQS
AENLIKRHDAFATTMDANDEKINAVCHFADRLIEDNHFAAEKIQKKAENINERRDSNRQR
SEEQLAKLKEQLQMQQFIQEWDELNDWLNDKMAAAQDETYRDAKNLHSKYMRHQAFESEI
AANKERLEAIKKEGEELMRNKPEMKEQIGPMLENIDSQWDNLEQTTKSKGEKLFDANRSV
LYTQSCDDVDGWINAIESQVITSEDFGKDLTTVNLLVQKQNMMENEMKMKEQQVQELESQ
AVHLKRLEPDREAEIEARKALVAERFAKIQRPLIQRRDQLEKVKRIHQFTRDIEDEKLWI
EEKKPLANSTDYGNSLLSVQLLIKKNQSLQREIENHEPRITSICDVGQELIDEGHPQSEE
FSSLMADLMERWQELKDSVEARRDRLVLSETAQQYYFDANEAEAWMSEQELYMMGEDRAK
DEIGSENMMKKHQILENAVEDYADVVRQLGERSRNLLETDHPECDQIAVRQSQVDKLYAG
LKDLANERRGKLAEVLKLYTLHREIEGLLQWISEKSIHANSNDPGVDFEHVTLLKERFRE
FARETEIIGQEKISVNNEVCDNLMAADHSDSATIAEYKDQVNEAWTDLLELIDTRTQMLQ
ASWELHKYCSDCKDTLENILEKQHQIPEELGRDAQSVAALQRKHANFENDLVTLGHQVEA
IQTESYRLQSAYAGDRARDIQFREAEVVEAWKNLHITVDRRRTQLADSSDLYKFFLMAHD
LRLWMDDIQRQMNTQEKPRDVSGVELLMNNHQSLKAEIDAREENFAICINLGRDLLSRNH
YRSDEVREKLIQLTLQRLDMTDQWTDRWEHLQLILEVYQFARDASVAETWLMAQDPYLNN
QDLGETLDEVEILIKKHEAFEKSAATQEERFAALEKLTTFELKDQQKRQEEEYNRAHPEE
MDRDVSTPKSATKPARRQLSPTSPDSPISRKSPDSPKSGDVPREEGMLVRKHEWESSDKK
AGNRSWDKVYSVLSGTQLSCYKDQKHAKSDPKNRIHHEPAIELEGASCYVATDYTKRPSV
FRLKLVNGGEYLFQAKDDTERDTWILRINGSTGSEGAASMPSRAQTLPARTDESKKEEHK
KRSFFTLKKK
Download sequence
Identical sequences V4CHJ2
XP_009047684.1.39240 jgi|Lotgi1|139452|e_gw1.136.98.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]