SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|160005|fgenesh2_pg.C_sca_23000023 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|160005|fgenesh2_pg.C_sca_23000023
Domain Number 1 Region: 24-156
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.06e-37
Family Calponin-homology domain, CH-domain 0.00042
Further Details:      
 
Domain Number 2 Region: 885-993
Classification Level Classification E-value
Superfamily E set domains 3.47e-25
Family Filamin repeat (rod domain) 0.00045
Further Details:      
 
Domain Number 3 Region: 812-910
Classification Level Classification E-value
Superfamily E set domains 4.47e-25
Family Filamin repeat (rod domain) 0.0013
Further Details:      
 
Domain Number 4 Region: 524-630
Classification Level Classification E-value
Superfamily E set domains 7.34e-20
Family Filamin repeat (rod domain) 0.0027
Further Details:      
 
Domain Number 5 Region: 167-261
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.93e-18
Family Calponin-homology domain, CH-domain 0.0021
Further Details:      
 
Domain Number 6 Region: 685-801
Classification Level Classification E-value
Superfamily E set domains 8.82e-18
Family Filamin repeat (rod domain) 0.0073
Further Details:      
 
Domain Number 7 Region: 277-357
Classification Level Classification E-value
Superfamily E set domains 0.0000000018
Family Filamin repeat (rod domain) 0.01
Further Details:      
 
Domain Number 8 Region: 447-538
Classification Level Classification E-value
Superfamily E set domains 0.000000867
Family Filamin repeat (rod domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|160005|fgenesh2_pg.C_sca_23000023
Sequence length 1017
Sequence
MQCLDILSFIIYHTLIQLWFSNERGNEDVVNGNLKLILGLLWHLILRYQISSSKTKVPPK
KLMLAWFHSILPDFNIANFSTDWSDGIALHALLDMCRPGLSPNWRNLLRKNRVENCRTAM
TTAKDQLNIPMMISPEDFASAALDEMSAMTYLSYFIKRDSPGYYSTLNWVCRQLKTTTVS
NLSTDWNDGYYLCGIVQSIGGNIPNWPDIDRNDYIANCKMGMEEAKRLGIDPILTPEEMA
DPSVDHLTIMAYLSKFQNFKPAEPRVEVENITLKADFKKVYQGKVQVFTVEIPNDLVERS
NVKVEVKSSSRNVICNPAWKGNKGEYIFTPKESGKHTIHVYYNDQEVPRSPQDFMVELDL
SSISIASSGLYSKLDGQWQVKVDVSKAGNSVVTMISTNPVGKTEDVPIIRTDNIITGSIR
PRISGQWTVRTYVDGHNTNKDVKFDVFNPNSCSLTGPDHLLVGETGKFYADSTETTNYEV
DLQLYDSNNQPISDFDCNTVNHRTQLTFRPLKMGRYKIVGEICGEPIKGSPLYVEINDSS
QIVASGDGLYRAAKGEKATFTVNTKKLKGNIIVAITVNNRNIDVGKRELYEGYYEYEYTP
VTHGEYNITITFGGLPVKGSPFSVQVTDHSSVVLLTDLSQLRDENGFMVLDFKKDTVLKL
DVSNAGPGRIKSEILGPTGGHYIHLYWSDVPLACSPIRGYCDGPVLPVDASKVCVSGEGC
ERARKDVTAQFTVDGRLAGPGTCRVELKGVKNDINVNIDDIKYNRYRCSYLSHNTGGYLL
YVYWSNKLIHNCPMKVSIGDKGAAAKVNLYGDGLQGGIAGEEMMFIVDAQDAGAGEVTAN
CRSQHHSAQCDVKDEENGRFKIWVRPPEPGKYLLIVTFDGTDIPGSPFVIRVGEPPDASK
VKAFGPGIENGLIYNYQSRFLVETHGAGAGKLAVRIKGPKAAFKAEMLREGKNDRTILCH
YDPTEPGKYTISIYWSGQEIPGSPFKSLIFESRDELDDFQRQNGDAIIENDQWRHEI
Download sequence
Identical sequences V3ZWX3
XP_009053144.1.39240 jgi|Lotgi1|160005|fgenesh2_pg.C_sca_23000023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]