SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|162645|fgenesh2_pg.C_sca_35000046 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|162645|fgenesh2_pg.C_sca_35000046
Domain Number 1 Region: 17-153
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-43
Family Calponin-homology domain, CH-domain 0.00000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|162645|fgenesh2_pg.C_sca_35000046
Sequence length 154
Sequence
MAFQNGFMSSDGTASPMIQYEENRKKDTDQRDAVQKKTFTKWVNKHLIKRSTQTVQFTFM
QHWRFSQTGRRIVDIFEDLKDGHNLISLLEVLAHEVLPRERGHMRFHKIQNVQIALDFLK
FKGIRLVNIRSDEIVDGNPKLTLGLIWTIILHFQ
Download sequence
Identical sequences V4ABA3
jgi|Lotgi1|162645|fgenesh2_pg.C_sca_35000046 XP_009056903.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]