SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|174075|fgenesh2_pg.C_sca_181000008 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|174075|fgenesh2_pg.C_sca_181000008
Domain Number 1 Region: 247-549
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.43e-73
Family Complement components 0.0000681
Further Details:      
 
Domain Number 2 Region: 627-759
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.22e-20
Family Alpha-macroglobulin receptor domain 0.0012
Further Details:      
 
Domain Number 3 Region: 73-173
Classification Level Classification E-value
Superfamily E set domains 2.66e-16
Family SVA-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|174075|fgenesh2_pg.C_sca_181000008
Sequence length 949
Sequence
MAENNVVPGPTASKTLNLRTHFPETWLWQLDTVGETGKLQKITEAPHTVTKWQGNTLCTN
PDVGFGLSPVASLITFQPFFLSFTLPYSAVRGERIPIRVTVFNYLEKCLLMEIKLNLWGG
IEIVQGSYQNKPFCLCGGKSHTTKYYIVPTEIGELPITAIAEILPGSCDNSVEMDLNYIG
MRDAAERNILVKAEGVQQEYSLSRYICLDSGKDEVVEQFDLQLPEQWVDDSARGEFTVIG
DIMGPALSNLDNLVSQPTGCGEQTMVTFTPNIYVLKYLQSVQQDTEELEALAKNYMEIGY
QREMTFRHDDGSFSAFGKSDKSGSTWLTAFVIQSFAQAREFIYIDTKDLEKSIKFIRTRA
RLENGCFREVGKVFSSYMMGGLDTSKDSSLTTLTAYVLISLLEANVSKEDPMIIEGMNCL
NAQEPTEDVYTMSVLTYANVLYNVNSTESVEALDRLNEQVIKNGNIEHWARKGPKPKPVN
SWYYFVAPSAEVEMTAYGMLSRLHSTDNIGDVVPLAMWMSQQRNSFGGYASTQDTVVGLH
ALSEFAAMLKQDGNGETTEGLKILFQGKSQENSLNVTSENALLLQTVNLKELSNFFDVTA
RGQGCALVQANVRYNIDPDDLDTGKIFALKVSARREENDCALKAMEICVSFYKHQGYSDG
MSLVTVSMVTGWSVEPKSLKRLRSRFSMLNMKKYEIDNTDGSINFYFDELDHRQRCFKFD
LIQNKDLAVSSPKSGIVKVFQYYEKEVSEVKSYSLKTICGTKEEIPIKPPQVLPPIDEPD
FIQRRVFDVRGSGDDSPIVPERVNPLTRLREVPSPRKNIKCPVCTNTPPDNLDDLVCQSG
SILKVSAGRNGRVTMKLKADLRPRRKQRLDEFVSVDLNSQCPCNLIKPPKRQKRVKRLLV
FTESPNLFDKEGQKEKAFDLTKAKYVINLDLDKKLERRVRLLARKCRTP
Download sequence
Identical sequences V4CA32
XP_009050651.1.39240 jgi|Lotgi1|174075|fgenesh2_pg.C_sca_181000008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]