SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|210615|estExt_Genewise1Plus.C_sca_60354 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|210615|estExt_Genewise1Plus.C_sca_60354
Domain Number 1 Region: 845-950
Classification Level Classification E-value
Superfamily PDZ domain-like 1.28e-23
Family PDZ domain 0.00047
Further Details:      
 
Domain Number 2 Region: 234-328
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.38e-23
Family Ras-binding domain, RBD 0.0002
Further Details:      
 
Domain Number 3 Region: 377-472
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.11e-18
Family FHA domain 0.00014
Further Details:      
 
Domain Number 4 Region: 42-134
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-17
Family Ras-binding domain, RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|210615|estExt_Genewise1Plus.C_sca_60354
Sequence length 987
Sequence
MAQVKSPTKEDRQRLSQQIHQWNTDHYDIFELSQPNELLEFHGVVRFFFQGGGANVSTKC
IRVSSTATTREVIDVLIEKFRPDMRMLTQSRYALYEVHVNGEERRLLPEEKPLFVQLNWG
KDVREGRFLLKNEDEPTIRQGQEIERAPQGFKRNLSKREKKELKKKREKEKKDEKTGVAE
KLYHDLPENSFTRSISNPEAVMRRRRQQKLEKKMEQMRAEEGRSDATTLISILGGTLKIY
GESVRPDVPYKTLLLSTGDTCKMVVKEALEKYSLPNEDPEIYCLFQVEYHGGTVGEERLL
EDTECPLAIVMQHPKNKGHIIFQLRRKPTNMKKKQKRAVSHDDLRSHSNREPNVMIPTDR
LPYLQELNSRGMTYQTYLFYGRGKRHHLPLNVTEIGSERSLSNSNQYLQLVSNDIQPRHC
VVAHTEGIVTVTPTSRDAETYVENQRIFETTMLKHGMIVQFGKHHVYRFYDPRFDEVDVN
SRAVQFKLASTYALYMAMRHLLSQKFQRPQRTTEFVKKISKLVQRSIQDQHNDPTALAFW
MANASEILHFFKMDHDTSHYSPEAHEMLAEAVQMAFHHLVRCLQGDLQKVMTAFLNPSDS
VEDEGDVITTLSAAMTLLRRCRVNAALTIQLFSQLFHFINMWLFNMIVSEPQLQMCTAKW
GNRLKRRLGRIEAWAEKQGLELAADCHLCRIIQAAHLLQAPKMTADDITNISSTCFKLNS
VQLRCLLSQYIPEPNEPPISPNFIKKLVEIAESMADLSTKSEGRDVMLEEDQDLHLPFLL
PEDGYSCDNIRGIPNGLQEFIKPLSNSGICHMIPNNNSSGSWTVYMGEPRSLSSTPPKSQ
GMPSPGAQVPGQNLPREPEVQTVSFKKVDRSMGLSIVAAVGENQRERGIYVKSVVPNGAA
ALDGRLQTGDQLLEVDGRSLVGVSQDTAALLMRETGDRVTLKVAKQGAIYHGLATFLSQA
SPTLGRGKVLKQYMIMVESLDSHLMYP
Download sequence
Identical sequences V3ZX65
XP_009062162.1.39240 jgi|Lotgi1|210615|estExt_Genewise1Plus.C_sca_60354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]