SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|231195|estExt_fgenesh2_pg.C_sca_180128 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|231195|estExt_fgenesh2_pg.C_sca_180128
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.15e-38
Family Calponin-homology domain, CH-domain 0.00049
Further Details:      
 
Domain Number 2 Region: 1252-1346
Classification Level Classification E-value
Superfamily E set domains 1.6e-21
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 3 Region: 1071-1176
Classification Level Classification E-value
Superfamily E set domains 2.27e-21
Family Filamin repeat (rod domain) 0.002
Further Details:      
 
Domain Number 4 Region: 513-629
Classification Level Classification E-value
Superfamily E set domains 9.34e-21
Family Filamin repeat (rod domain) 0.0014
Further Details:      
 
Domain Number 5 Region: 1163-1253
Classification Level Classification E-value
Superfamily E set domains 2.67e-19
Family Filamin repeat (rod domain) 0.0017
Further Details:      
 
Domain Number 6 Region: 424-514
Classification Level Classification E-value
Superfamily E set domains 1.27e-18
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 7 Region: 1344-1435
Classification Level Classification E-value
Superfamily E set domains 2.67e-17
Family Filamin repeat (rod domain) 0.0025
Further Details:      
 
Domain Number 8 Region: 1433-1526
Classification Level Classification E-value
Superfamily E set domains 3.87e-17
Family Filamin repeat (rod domain) 0.0044
Further Details:      
 
Domain Number 9 Region: 339-431
Classification Level Classification E-value
Superfamily E set domains 1.87e-16
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 10 Region: 714-806
Classification Level Classification E-value
Superfamily E set domains 1.87e-16
Family Filamin repeat (rod domain) 0.0043
Further Details:      
 
Domain Number 11 Region: 1627-1712
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000153
Family Filamin repeat (rod domain) 0.0064
Further Details:      
 
Domain Number 12 Region: 904-982
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000554
Family Filamin repeat (rod domain) 0.0065
Further Details:      
 
Domain Number 13 Region: 982-1068
Classification Level Classification E-value
Superfamily E set domains 0.000000000000012
Family Filamin repeat (rod domain) 0.0041
Further Details:      
 
Domain Number 14 Region: 1716-1792
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000133
Family Filamin repeat (rod domain) 0.0048
Further Details:      
 
Domain Number 15 Region: 817-895
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000133
Family Filamin repeat (rod domain) 0.0016
Further Details:      
 
Domain Number 16 Region: 1524-1615
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000454
Family Filamin repeat (rod domain) 0.004
Further Details:      
 
Domain Number 17 Region: 157-241
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000103
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 
Domain Number 18 Region: 639-726
Classification Level Classification E-value
Superfamily E set domains 0.00000000028
Family Filamin repeat (rod domain) 0.013
Further Details:      
 
Domain Number 19 Region: 240-335
Classification Level Classification E-value
Superfamily E set domains 0.000000000594
Family Filamin repeat (rod domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|231195|estExt_fgenesh2_pg.C_sca_180128
Sequence length 1899
Sequence
MIDRNTTGSEDIVNGNQKLILGLIWHLILRYQIGKTKFPPKKLMLAWLQAVIPDCNISNF
TSDWNDGVALHALLEYCKPGLCPNWKQLSRQNRLENCSNAMHVAKNEFNIPIIVRPEDFS
SPHLDDLSGMTYLSYYMTVDSPGYHATLRDVRSLLKHGSINNFTTDWHDGKLLCNITKSL
GVEPQGWPNMTSNNVENLQAGMDSAKKLGIEPILSAKEMSDPDVEHLGIMAYAAYFTRLT
PRKVVAEKASVNGDFSNVQVGQEKSFRVSVDSDVLPHDVRAEIIGPDSIVPVRMNWSGKT
ANCTFTPTETGNHKLNVYCEGQVISECPINFKVTSDRSRVSCRPIERCPMGVVTDMKVDT
SAAGRGNVQIEARSPSGRVHNLPVSDNGGIHNGNFNPTEVGEWQMNVTYDGQHVGGSPYT
VKVFDPNAVDVYGLDGGAVGKALAFNVDSSRAGDGDLDVTVNYQGQNIPCYTTQESNGHH
KINFTPQGAGSYKVNVRFAGEEVPKSPFTLEIVDSSMVSVTGDGLSLVPVNRPATFNVQT
QGAGGGNINVDVVFFILTLNKEKYFEICTCDLNLAPNGKKISKKIIKENEENYRIEYYPE
EAGDYKITVYFYDQPLRGSPFTCKVYDLGKLTVRNMPKTVLAGNLVLFDIDASLAGSGNI
EIRVNEGRVACSVENKGGHQFVASFLPEAPITHYVEMTFNNAPVDGSAWKVYVMDPQQIT
ASGSGLELIPINHRAHFKIHSDGSPLDDVKIIVKAPNDETITSNITLIGDDIRVEYTPTE
VGDHEIRVICGESQVNGSPFIAKAYDTSAIVVDPPDDGYVNKPIYFSIDVQDAGEGQLQI
MVNNGNLPNEVEVQDDGIYSISFIPVESGPQTIDISFNEEHLPGTPLTCNARDLSLAMVN
INPVEIVNRQTEFVIQTKGNEQFNCAAQVFSPMGQKVPVQITGNSASGFRVEYTPRDIGT
YTVTASLAGIPIKGSPFRVKSFDPTQVKVSKMPQGIVGIPCKFIVDASSAGEGTLELTVG
AHGRNIPNQARSLGGGRYEVSFVGRQAVKHQANITYNGIPVPGCPFEIDFLDASRITADG
EGLSLVSCHRSANFTVHAPGAAMPDLSVRVMSPDGRETPARIRQKNDDTFSVEWTPHMIG
DHRVVVEYAEMSINGSPYIVKAFDASMVKVSHIGQGYLGRPVPFTLDASEAGDGNLEIQV
TADHDSVPNYVRQDGDMSFKVSFTPQKARTHHVNIRFNGEPVPGSPFQCRILDSDRVIVS
NDSVKQIPSGVLASFKVDPQDAGEGDLEVKVISPTGHEIPARISGSSHSNYKVDYTPQEI
GRYKVYVEYGGVEVKGSPFISNVYDPSLVKVEYPNRAYLGRPIYFHVDASAAGQGELAAE
IKSHGQLVPSQFREVGVGRYELSFTPKDMSTHNVTALFNNYPIPGSPFHVDVIDTSSVTM
SGQGLRSAQVYRETWFNLDLHGMDDTDLDVQIVSPSGHELPCKLSRKGHICRAEFTPMEV
GSHFIDVFFAGNKLHGSPFISHAFDPSLVRITDVDRTGKKEREIGFTVDASMAGVGELEA
VVTHNGHKVQTYRESIDEGRYRYTFNPGESGHYEVNATFNEEPIPGCPVVINVEDEIPTF
ITISFRSVEALNVNEKNHHFMLHMNGKQIDMNLLNIAIQAPSGEQVPAHLVTQPNGDYKV
EWTPNVAGRHMVDVSFAGQQIQGSPFYIEVFDIARVRVDNFYNGNVNEPAGFTVDGTRAG
KAEQTLMITSPSGRTVPFEIVEGRAGEHNVTYRPVEVGKHKIQVAYGGLDVNDTKQDSTY
MDNLFIQNKIPHTWMTCSLDKKQGSTYMDNLFIQNKIPHTWMTCSLDKKQGSTYMDNLFI
QNKIPHTWMTCSLDKKHDSTYMDDRVSNGNKTSPGTIAL
Download sequence
Identical sequences V4CAL0
XP_009050461.1.39240 jgi|Lotgi1|231195|estExt_fgenesh2_pg.C_sca_180128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]