SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|234225|estExt_fgenesh2_pg.C_sca_480042 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|234225|estExt_fgenesh2_pg.C_sca_480042
Domain Number 1 Region: 42-173
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 4.71e-28
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|234225|estExt_fgenesh2_pg.C_sca_480042
Sequence length 181
Sequence
METKILLLAVLVAGALAGPINVRYGNDNTMCAQKCTESSKFRYRPGMTYEFDYNVQTLTT
MEGAAEEKATLGLKATAHVEILSKCELALQLRDVRVYQSDPTTAMKPVDSSEFRSALESH
PLRFAFQDGVVEELCPESGETSWALNIXRGVLSTFQNAMDSFESEQSVHEPTIRKVRRLG
N
Download sequence
Identical sequences V4BLL8
jgi|Lotgi1|234225|estExt_fgenesh2_pg.C_sca_480042 XP_009059667.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]