SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379704547|ref|YP_005203006.1| from Streptococcus infantarius subsp. infantarius CJ18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379704547|ref|YP_005203006.1|
Domain Number 1 Region: 3-82,178-341
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.08e-52
Family Bacterial dinuclear zinc exopeptidases 0.00000108
Further Details:      
 
Domain Number 2 Region: 70-183
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 2.29e-29
Family Aminopeptidase/glucanase lid domain 0.00000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379704547|ref|YP_005203006.1|
Sequence length 345
Comment Cellulase M and related protein [Streptococcus infantarius subsp. infantarius CJ18]
Sequence
MKTTVDYITKLANIPSPTGYTSHIMNYVIAELENFGYAPVRTNKGGVMVTVTGKDDSKHR
VVTAHLDTLGAMVRAVKPDGRLKMDLIGGFVYNAIEGENCTIHVAKNGKKISGTILMHQT
SVHVYKDAGTAERNQANMEVRLDEKVTNEKETRALGIEVGDFISFDPRVVVTESGFIKSR
HLDDKVSAAILIELLKEYKAQNITLPYTTHFYFSAFEELGHGANSSIPAATVEYLSVDMG
AMGDDQQTDEYSVSICVKDGSGPYNYELRQHLVTLSEENKIPYKLDIYPYYGSDASAALR
AGAEVKHALFGAGIESSHSYERTHIDSVQATERLVDAYLKSPIVE
Download sequence
Identical sequences B1SDK6 H6PD31
WP_006531683.1.40857 WP_006531683.1.53350 gi|379704547|ref|YP_005203006.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]