SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379704931|ref|YP_005203390.1| from Streptococcus infantarius subsp. infantarius CJ18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379704931|ref|YP_005203390.1|
Domain Number 1 Region: 11-393
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.31e-137
Family ArgJ-like 0.0000018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379704931|ref|YP_005203390.1|
Sequence length 397
Comment bifunctional ornithine acetyl transferase/N-acetyl glutamate synthase [Streptococcus infantarius subsp. infantarius CJ18]
Sequence
MKVIEGNVASPLGFSADGLHAGFKKRKLDFGWIVSEVPASVAGVYTTNKVIAAPLIVTRQ
SVKKAKKMKAIVVNSGVANSCTGVQGMEDAYTMQKWTAEKLGVEPNLVGVASTGVIGDLL
PMDTLKTGLSKLVVNGNSDDFSKAILTTDTMVKTVAVTEKFGRDEVTMAGVAKGSGMIHP
NMATMLAFITCDANISSETLQLALSQNVETTFNQITVDGDTSTNDMVLVMSNGCTLNEEI
LPNTPEFDKFSAMLNYVMQELAKMIAKDGEGASKLIEVNVKNAPNALDARMMAKSVVGSS
LVKTAIFGEDPNWGRILAAVGYAGVDVPVDNIDIYLGDVPVMLKSSPVEFETEEMQDVMH
EDEITITVDLHAGEAQGKAWGCDLSYDYVKINALYRT
Download sequence
Identical sequences H6P9H8
WP_014334475.1.40857 gi|379704931|ref|YP_005203390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]