SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|159103361|gb|EDP42256.1| from Malassezia globosa CBS 7966

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159103361|gb|EDP42256.1|
Domain Number 1 Region: 74-508
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.74e-103
Family ArgJ-like 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|159103361|gb|EDP42256.1|
Sequence length 510
Comment hypothetical protein MGL_3505 [Malassezia globosa CBS 7966]
Sequence
MWYRTFRTLGYTICRPYATCATKAERFVKTIDPSTLPRGYLVSSTYAGIKNAIRPVTSTN
EPSAATTNVPHPQEAPKPDVALIVSSVPAAIAGTFTTNVFKAAPVVHATTALKAAGPNAR
VRAILTNSGCANAVTGQQGLEDTQTLVNRVQALLSPRNQNAIPTYEQDARSSSTDVLMMS
TGVIGVRLPVAHIQRCLEHLAAPSILQSHPDAWLEAARAYMTTDTFPKIRTRQFILGNRR
CSIVGIDKGAGMIHPRMTRSGGQLHATLLGVFATDAPISSATLQRCLDEAVRVSFNCISV
DGDMSTNDTILALANGQAPFVDLDCTDTPNEWTETEHPDMVNKFAEELKSLCIEMSHLIV
RDGEGAEKFVQVHVRNAGTYEQAHAIASSISTSALVKCAMHGEDANWGRILCSAGYASLP
ASTPAWTLDPSKVNVTFLPPPHQPDDLAPLPTLVNGVPQAVNETQAKKLLSYEDIYVDVD
LQGGSWGSQGRSEATYWTCDFSKEYITVRW
Download sequence
Identical sequences A8Q9M0
gi|159103361|gb|EDP42256.1| gi|164656685|ref|XP_001729470.1| gi|306530913|sp|A8Q9M0.1|ARGJ_MALGO XP_001729470.1.82384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]