SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|159103937|gb|EDP42829.1| from Malassezia globosa CBS 7966

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|159103937|gb|EDP42829.1|
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 5.17e-39
Family Nip7p homolog, N-terminal domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 95-170
Classification Level Classification E-value
Superfamily PUA domain-like 7.18e-24
Family PUA domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|159103937|gb|EDP42829.1|
Sequence length 180
Comment hypothetical protein MGL_3029 [Malassezia globosa CBS 7966]
Sequence
MRPLTDAETTTLFEKLAHYIGKNLVHLIDRPDDPYVFRLHRDRVYYVSEANMRLAVSVAR
PNLMSLGTCFGKFSKTGKFRLHITALDYLVQYARYKVWIKPNGEMPFLYGNHVLKAHVGR
ITDDTPEHAGVVVLSMSGVGLGFGVTARSTSDTRNMDPTNIIVFHQADVGEYLRDEETLF
Download sequence
Identical sequences A8Q6Q0
gi|159103937|gb|EDP42829.1| gi|164657834|ref|XP_001730043.1| XP_001730043.1.82384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]