SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|164659076|ref|XP_001730663.1| from Malassezia globosa CBS 7966

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|164659076|ref|XP_001730663.1|
Domain Number 1 Region: 37-131
Classification Level Classification E-value
Superfamily MTH1187/YkoF-like 2.22e-17
Family MTH1187-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|164659076|ref|XP_001730663.1|
Sequence length 153
Comment hypothetical protein MGL_2459 [Malassezia globosa CBS 7966]
Sequence
MTAPATELYAAAYVIKHFSPSGTFAVCDSLYISNKIVIPIGTATTSVGAYIAECQRVLSS
MADEGIHFEVSSFIKILTLVQLHGYGTNVEGPISAVWRALQRCHEAVHAMGVERIATDIR
LGTRTDKQNDAPEWSNGLTENQRKRESVLRRLG
Download sequence
Identical sequences A8Q3N9
gi|159104559|gb|EDP43449.1| gi|164659076|ref|XP_001730663.1| XP_001730663.1.82384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]