SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212213391|ref|YP_002304327.1| from Coxiella burnetii CbuG_Q212

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212213391|ref|YP_002304327.1|
Domain Number 1 Region: 26-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000615
Family HLH, helix-loop-helix DNA-binding domain 0.0057
Further Details:      
 
Weak hits

Sequence:  gi|212213391|ref|YP_002304327.1|
Domain Number - Region: 161-243
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00122
Family HLH, helix-loop-helix DNA-binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|212213391|ref|YP_002304327.1|
Sequence length 295
Comment hypothetical transcriptional regulatory protein [Coxiella burnetii CbuG_Q212]
Sequence
MRHENPHYSNEIKFDDSEQNKKMKKRKISPEERKAKHKATEAQRRERISESFDALFQSLS
KKDTEVSDLKGKKVKKEIKTEKEIKILNLACITIEDLKKKLSIDGKNATQDRETSENNQE
NETKVSKKKIDVTLSQSLGKAPEEGEGQAIRKQTISAHPKEIELRPPTVLGHREKEKQIR
ENKRRYVNRLYNLIPRNYFENENKYSKKAQVPYSYIQIFGAAKQYIEKLKLLVKTTENYV
QSLSSPITVSSDQPFTFNFSNQPSSEFSSSYSLQSGNIEPESPLSSRNPFRFFLR
Download sequence
Identical sequences gi|212213391|ref|YP_002304327.1| 434923.CbuG_1937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]