SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|58899|estExt_fgenesh3_pg.C_230018 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|58899|estExt_fgenesh3_pg.C_230018
Domain Number 1 Region: 360-531
Classification Level Classification E-value
Superfamily Hsp33 domain 5.36e-40
Family Hsp33 domain 0.0000302
Further Details:      
 
Domain Number 2 Region: 553-598
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.0000000000811
Family HSP33 redox switch-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|58899|estExt_fgenesh3_pg.C_230018
Sequence length 602
Sequence
MDWLGRNDVREEYVLVIDVDMILRAPLLPEALGARPGFAVAAFFDYLHGTHNELAERHLA
DVAPRQDELAGPAGRRADMVGGAYLAHREDMRRIAPLWLKYTENVRDDPRAWELAGEPGR
APGERPWICEMYGYSFAAARLGVWHRADQSLMLYPGYYPADPLPRVLHYGLLWNVSAGYE
FNKHWHFQFDMLACPPWKLGESGLFKHPAHPRSLRSKGAELLKDLLAMEAIIYLNAAFCE
RHRARCPHSKALNWECSKAETLLKAYDAAWKAAVLAITDRDLKTAEALNWCKVNRLTYDC
CVKTRGTRANCRGDCPSISDNGQVSIMVVRGTQVVQEAFPPLCVLRREAPSSSSHARRLQ
ACTRHQTSPTASAALGRALLGTLLMGAFREQGEKTQVTFKGDGPLAGLQVIADASGTVKG
KVGNPAADPPLRPDGKLNVGQAVGRGEIAEDLARYLVDSEQVQSALGLGVSIAKDLSIRA
AGGFLIQVLPFAEDETIAQLEENIAAAGSVTDMLNAGMGAGDITERLLRGLGGNDTGFQL
QPRYGPCEPSDLQDRMRSAVALLGESEVRAIVAEQGKIEVMCEFCRETYAFEEEEVLRAL
QT
Download sequence
Identical sequences E1ZPN9
XP_005844395.1.22496 jgi|ChlNC64A_1|58899|estExt_fgenesh3_pg.C_230018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]