SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|136937|IGS.gm_18_00043 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|136937|IGS.gm_18_00043
Domain Number 1 Region: 1198-1455
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000108
Family Tropomyosin 0.003
Further Details:      
 
Domain Number 2 Region: 965-1199
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000111
Family Tropomyosin 0.0049
Further Details:      
 
Weak hits

Sequence:  jgi|ChlNC64A_1|136937|IGS.gm_18_00043
Domain Number - Region: 1506-1710
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|136937|IGS.gm_18_00043
Sequence length 2390
Sequence
MTQREPLGPASANSAAWSGPFGSPAKLFPSLGGEDEAGEPAISAESVAKNAARVIEALEA
ESPPEQLEDSQGSRTGARTPAEQQQAAELAVVPSSGGGQRIDTVLIRRLASEVAADADVV
AAWEEAEALRQQLRLKDAELQTALEALAAAQAFGESPRSVQRHQETAGQQLARFLKDQLS
MRDGQLVAAQEEAAELGRQLQQRERQLAASEEQLGAAQTALLETHHEAEALRRQQAGMQQ
ELEVARAEAAEQAEAANYARLEVEEARRDAAAQLQQLRSELCAVEARANLTAYGTPGGSW
QEPEGSISLQQPGTAYHSVGDEVGVDGPAAAAEQEEEEEVDDVFSSPVLSNLRASSSPEQ
RSQQQQQHAGSSFQFATATADSGNGAAAPADDDGSSSGGETEVTVSEAAVVARTLTRASV
LQKDREHLREQVRDLSQELRDLKGRQKQMAQHLQAAHADGGIAGGGSRAGGRPQQPTRQR
PQQAPAAQRAAAAADGGDAGLEERCRLQAVEERHLRSEVEMLNRKCDKGNEMLLKANHAM
KILHYKLQKERKAVGRLQEEMCTLQAQLLSGGGGGGGDPRQLAALLQELQSGRTRIEVLV
EEKAAMAAKLEAVATGGRSSSREQREAAAATLAALQQQQEATSAALREELAAERGRAAAL
AEERGLLEGRLQEALGRLGAAEQISGHLEQMNAYLQEERQRCQELASALGREQQGSESRA
AEVARLSALAQHSTEEVMAAREAAQAERSRAEQLLRDKAELQGKVLALQETLQRLEKADD
VLLRLTEDKASLQLQLHESQVAATRAQSEAEERGRHAAEVDGTCQDLRRQLDAAMAQHDV
AHAAVEGAADQMQQLTDSHEALERELAAAGAQLEAAQGELAQRAQQAPQLEQRVTALEAE
LRQGLQQRDAALAQLQELHRGLGAAQQEAAAQHQLAAEGRERLAAAATEHEGLATQLAGL
QAENDNLKDNLKALEAECEAVRRLGANVDQTNQTLVDNMCDMSGLVDAVQALQQRNRLLQ
QDLDTLKGKYTDLHRGHEAQTRTLHAAQKELAAQHRQHLELQAAHAELQEQASRLRAELA
AAQAQRDQAAQLHKEAEQELGALGERLAQAEASLGESRQEAQKAVQQQQEAAASAAELLQ
QLGEAQRQLAAGAEEKRERGQQQEAMQQQLAALQKKQSVADGKLVLARQREAQFKEASKQ
LKVLQQELLTFVKDAQVHRQRREEAEHRCEALEARCLALEQQAQQLGEQLATEEGEREVV
ATKQAALQGQLAEAQLSVAQLEAQQETFQSVQQRLSELETEQHSAAEWFDALTGELTDKT
DQLAALELKLQAAEQQAAEAAVQLAEAQEQLAGVSEARSVAEAAHAESSCGLEQVQRELA
ERQRELAERQEQLEAAEAVAAEISVQLVLMQAGKEEAESTLAAVQQQAQQAQHECAHLQQ
QLAATEAGGAAVQAEQQQRIDQLYRGLFVMAAVHEAGVRELQAAAASANDQHSATLSAAQ
QQHAAELAAAREQHAAARAAAQEQHTAAMAAAEERHAEAVAGAEEQHRQQAAVLEAAVAD
LSAQLEAASSAHQAASERCSGLEAELAARAELAASLEQQLAQAQAEHGAAATALSCTERR
HQQVAADAEMHERHAQQVEQQCSVLREQLAFLHEQQLSDSDECGSLKAALAAATGESASL
HQQLAEARRAAEAAAGEQQRLQGELEAAEEAQQATQRREAGLRQQLAASAAAAEEAQQAA
EQSRVELASAECQADRLRQQLEVEEDRRREVERQLDAADVERERLLAKAQVHDVLEGLSS
RLQAQMELLQRIESASPAAALAPDGQVDSLAGGSKGQLASRRELLAQALEKLQALKTENE
QLWRMLEDHLSGSSSPAGDGSSGACARPNLYVEHLEAEREQLAAQLAAAQQEHADAAARL
ASQQAAIAKLQAVVQRLSAAGGKGGSPGIGAGLPLLGPAADDWPCPALSMPASEQQHSGM
NDGVPAGGGEGWQTEKRLLKAICKLALGVTMDHMGGRQEAASLADELAPLMAAHAATLRL
LGLHKVWASLQQLAVTGGAAAAAPGHSLQPPTQQQQGSSFPAAVAGDESGDVWALQQRLQ
QYKAKCRGLKATVVALEGAAARWQSQAVEVEQGLALLRFRLADLLSEVKWVLEDYSETDA
GATAAAGEGGLGSRQLAALVEQLGKGLRRILRKYKTLAGHLHDSQDSSGGDYPLHQHHQH
QHQHEPHAYARRRHHQPAPCHQPAHSGEGQEVSSIDEGGGRGGGTCASQASSWAIGAGRH
SGGSAADPSSAYGGAASEAMAEAGRKAASIAAKLDRLLTPQSRAAVHGGGGVGWTSRFAT
GEVGGEAQAEEVEEEPGHYGRPHQQQLWPAPAGDPEEVPLRQRFGSAPPF
Download sequence
Identical sequences E1ZLM3
jgi|ChlNC64A_1|136937|IGS.gm_18_00043 XP_005845261.1.22496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]