SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|138760|IGS.gm_22_00001 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|138760|IGS.gm_22_00001
Domain Number 1 Region: 378-506
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000149
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 2 Region: 758-814
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000258
Family Fibronectin type III 0.0045
Further Details:      
 
Weak hits

Sequence:  jgi|ChlNC64A_1|138760|IGS.gm_22_00001
Domain Number - Region: 601-710
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000126
Family Fibronectin type III 0.0082
Further Details:      
 
Domain Number - Region: 536-588
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000594
Family Fibronectin type III 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|138760|IGS.gm_22_00001
Sequence length 898
Sequence
MLQPIAAAGAAALQGTATGPRAALFFSLTLLGIKSKQDFNAGMKVSYKNTLMRMAPGSTI
IPVAIEPDDTGQSIHTVALFPGSVAAGTVAAQQLAAKLRAGGLNAYFDQRKFRRVHAEVV
ADPYLADSTGDTIPSLPGSRPVAMITVKWYDLAPDQVTAQKRKAYVAAIQKLVPAALQKL
AMDTLMSNAAPTALAKALNTMRTRPASFGQMASDDGYAVRWVPDSSFVSPCDVHTTLTLA
GINVYAPSCTRQLVTAYLAALKTKLPSDVVTSVVSAMHVSSGCRVVTSSAYPGSQQGAAM
DLAGRKVPSNYPLNGTVFGAGSKTPAFFAEGAAATGQQRGMVTARHLLLDAAAYEYKLQP
VNCAPGKSCPTLTFTFATADAYFSGLSPGTTYNVTVEGISNTGQRTAGQNTLQFTTPASV
HLESAQATSSTTATATATTQPAGAFPQYMYSLRKLGCITCKSLNFPSSTATVNLHGLEPG
ATYNVTVEGISKTGQRTPGDNMLQLTMPAGLRLTQAKATGYTTGAATARALPSDAFTKFV
FTVTKARCTVPPCPTLAFTSRAPSNQLTGLEPGTKYNVTVLGVTKTGQRTKGANMMQLTT
YMFTVKKALCPGCPKLEFNSSTRMGTFTGLAPNTAYAVTVAGVDWSGRRTQGSNSLQFKT
PTKSAPPPPPTPTLKLTSARATTPTTAIATASPQPPGAFVKYNVTVAGMDKSGRKTQGIN
MLQFKTLDAHPHRLVWPSLVQFIFTVKKAACPSCPALHFTSNTTLGVFSGLTPNTTYQVT
VVGMDKTGRRTPGSNALHFKTPAGAFLRAPPSPPPVAPKSLMLISAHATSPTSGTATAQP
QPAGAFVKYIFTLQEVACPSCEPLAFSSTTSVGIFTGLKPNTKVSMCRVTAVDSGRQT
Download sequence
Identical sequences E1ZNP5
XP_005844553.1.22496 jgi|ChlNC64A_1|138760|IGS.gm_22_00001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]