SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|141289|IGS.gm_32_00127 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|141289|IGS.gm_32_00127
Domain Number 1 Region: 667-815
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000687
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number 2 Region: 254-384
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000469
Family Fibronectin type III 0.0061
Further Details:      
 
Weak hits

Sequence:  jgi|ChlNC64A_1|141289|IGS.gm_32_00127
Domain Number - Region: 413-466
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000112
Family Fibronectin type III 0.0055
Further Details:      
 
Domain Number - Region: 481-584
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000218
Family Fibronectin type III 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|141289|IGS.gm_32_00127
Sequence length 932
Sequence
MDAYYCNGGEIELVTYKTHLDDGDWTGAGGNPALQKLAMDTLVSNAAPAALAKALNTMRT
RPASFGQMAPDDGYAVRWVPDSSFVSPCDVRTTLTLTGIIVYAPSCTRQLVTAYLAALKS
KLPSDVVTSVVSAVHVSSGCRVVTSSAYPGSQQGAAMDLAGRLVPSNYPLNGTAFGAGSK
TPVFFAEGAAATGQQRGMVTARHLLLDAAAAMSPTTGKASATPIPGSAFAKYEYELQPVN
CAPGKSCPTLTFTFATADAYFSGLSPGTTYNVTVEGISKTGQRTAGQNTLQFTTPSSVHL
ESAQATSSTTATATATTQPAGAFPQYMFSLRKLGCITCKSLNFPSSTATVKLHGLEPGAL
YNVTVEGISKTGQRTPGDNMLQLTMPAGLRLTQAKATGYTTGTATARALPSDAFTKFVFT
VTKARCTVPPCPALTFTSRAPSAQLTGLEPGTKYNVTVLGVTKTGQRTKGANMMQLTTYM
FTVKKALCPGCPKLEFNSSTRMGTFTSLAPNTAYTVTVAGVDKNGRRTQGSNSLQFKTPT
KSGPPPPPTPTLKLTSARATTPTTAIATASPQPPGAFVKYNVTVAGMDKSGRKTQGINML
QFKTLDAQRPPPRPTPAPGLNLTEARGLNPTRGMARVSEKPAGYFAQFIFTVKKAACPSC
PALHFTSNTTLGVFSGLTPNTTYQVTVVGVDKRGQRTPGSNALQFRTPASGFLRTPPSPP
PVPPKSLRLISADATSPTSGTATAQPQPAGAFVKYIFTLQEVACPTCEPLAFNSTTSVGI
FTGLKPNTKYKVTVVGQDSTGGTTAGSNMVSLTTQPFSKGPSINGTESVTATSGIIDLLP
PSGLTCARFIVEMCPMPRTYNVTVNGVDTSGSTITGSGMAQLTTQVASPPVPPPSGICPG
YQQHLRHGHGHSPSRWKLHRVHFHGTTFVRRA
Download sequence
Identical sequences E1ZSJ3
jgi|ChlNC64A_1|141289|IGS.gm_32_00127 XP_005843358.1.22496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]