SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|ChlNC64A_1|51727|fgenesh3_pg.C_scaffold_8000014 from Chlorella variabilis sp. NC64A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|ChlNC64A_1|51727|fgenesh3_pg.C_scaffold_8000014
Domain Number 1 Region: 909-1002
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000392
Family B3 DNA binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|ChlNC64A_1|51727|fgenesh3_pg.C_scaffold_8000014
Sequence length 1056
Sequence
MSSPQPSPAAAVAAGAGVGSSPLLVPCSWQQLQPQASAPLSADASPPRAEAAGSGAAAQH
DPAAAAAATALSHLAVMVPALPAAERQQGQAGAEAAMHDCYQQGASLLQLESGCSQLASS
PASAAAAAAAPPATTAMPAASPRATPAEPQRGSAGQQQQQEHTQAVTWQPPLPSLENSLL
CTESSLSLERAFALASSGHAAADRPAQMVPAAAIGGSNPRSSGGLLGSGTSGGDERDGGL
CQQPLPPPPPQPAADFFAAAYVAAAVAAASCLPSHPGPASSSRGAVPAAWAAPPRMLAVS
VNTMDGKEAGSRQQTWEPLSAAAAPPPAPQQMRATPPSPQQAGSPLSTPSRGTVAAGAPA
AAGLPLSFGSPAGMLGGLGSPLSSLRSPTLGGLGSPLACIGSPLAAPPVGGRGGGAKQRG
GASLCDLVRLDAGRAPAGSPGPEQLHLRAATAFRRLPCFLPAAANLSVSATCFMYCPVLQ
DTMYSRLLSQDLDPYQDGSARAPTGVPTAAGAGASTATCTATALPPQPPPLPLALAGQSA
LAPVVPLPHLTMLATPRITTAAAPGEHQSPAAGGASPLPRVAAPATAQLLPAVPTPAVAA
SPLAAAAQAVAWPQFLLPQVALLHPNGQLFIPNLQPFTFLLPQQPQAPHQQLSPPPAPPL
LTPQRQQQQEGQLERRPDQEREQHQAAEKEAAVAAEEAEVERPAKQGRVLRPSKDQQASA
ATQTKPENTPLPSLKRKKQQKQQGKPPLPPKRQWPASAKPTTAAAAPAAAAAADGSGSGA
SSSRTAAWSAGGSRSTSPSMRKRPRKPANRGAATPLLPAAAATAASTPPAPAAAASAAAA
APPPPPPPAADPAVPAGAGAGVGEGPLSRVQLLSNGTAQEAAEPAYVTFQLPTTSYGGVL
GTCPVRCRFLFQKPLSASDAGKLGRMVVPRCAAAHLPECGKGGAVVDVQDKLGRQYSWRL
KAWESGEGPKRTYLFEQCRPFQQAWQVQPRTTLAFYQMPSGALLRLNDAELHECSNAINR
RGLAGSYGCASNSASRATSAMPPPRPLVTPATPQSS
Download sequence
Identical sequences E1ZCT8
jgi|ChlNC64A_1|51727|fgenesh3_pg.C_scaffold_8000014 XP_005848204.1.22496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]