SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206895372|ref|YP_002247317.1| from Coprothermobacter proteolyticus DSM 5265

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206895372|ref|YP_002247317.1|
Domain Number 1 Region: 75-153
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-25
Family Translational machinery components 0.00027
Further Details:      
 
Domain Number 2 Region: 3-71
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.36e-22
Family Ribosomal S5 protein, N-terminal domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|206895372|ref|YP_002247317.1|
Sequence length 162
Comment 30S ribosomal protein S5 [Coprothermobacter proteolyticus DSM 5265]
Sequence
MDMTNLQERVIEIRRVARVVKGGKRLRFRALVVVGDGEGHVGVGIGKAGEVPDAVAKAVT
RARKNMIEVPLAGTTVPHTVTAKAETATVLIKPAVKGTGVLAGQTVRAILEMAGIKDVIT
KSMGSTNPVNLAYATMEALKSLKRPREVAELRGVSIEQILKR
Download sequence
Identical sequences B5Y970
gi|206895372|ref|YP_002247317.1| 309798.COPRO5265_0995 WP_012543719.1.90209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]