SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206895520|ref|YP_002246672.1| from Coprothermobacter proteolyticus DSM 5265

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206895520|ref|YP_002246672.1|
Domain Number 1 Region: 449-474,536-628
Classification Level Classification E-value
Superfamily TPR-like 0.0000000717
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|206895520|ref|YP_002246672.1|
Sequence length 634
Comment hypothetical protein COPRO5265_0305 [Coprothermobacter proteolyticus DSM 5265]
Sequence
MKIRELRDFGFFAIKEALLILPIVLSVAVPKTFLGTWGLLYAFTAPSAVVLAFSRRTWSS
FTYPKAHFLSAMAVLGGIILFRSQTSFFASWAVLLYAILLAVHPFFKGMVTAVGNSERST
GAWIRLSALFVGLVIWNLTRFSPYEVKLWILTVPPLVLSLSIIFAGRNWIFLSGKASFGR
EFGSMGNPMPASSLLVMALPVVSELTFLGVSTGRYWYLLVLPLYAYGFFASAGRGAVFGV
LLSVPFIAYLGFQYSPWWLLIGILFFVVAALAARKYLKELWQRVVWTFKRGLTKEPRFFL
WRDTLYFCVKEPLGSGYDNFRRSFMPYRSKESYLAEPTVHYDKVHNVFLEEWAEGTVVAF
VLLIVILVELFLKGTLTLKGAIFAVIGDGFFGIYNPANWLYLWMLGSLAPLSSVFSVYWL
YPCWALVVFAFVLTSLNHMPQVTAGNAHSSRLAGQRDIAAQLFNAAYTVFPWCVDYLSEW
ALLQMALLNEAKLNDDMAVGYHNTFKGLQPYLDRFASNIDDIYSSWLMFCGKYASLRKEG
EAIYGRLQQVNPYSFRVRKACAHYLGNVGDWDLAMSFLEENINEYPFDADSYYMLVLACY
EQHLWSTGRKYLQLWRDRFPNDSRLTELERALGI
Download sequence
Identical sequences B5Y7C5
WP_012543867.1.90209 309798.COPRO5265_0305 gi|206895520|ref|YP_002246672.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]