SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397685503|ref|YP_006522822.1| from Pseudomonas stutzeri DSM 10701

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|397685503|ref|YP_006522822.1|
Domain Number - Region: 25-73
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.1
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397685503|ref|YP_006522822.1|
Sequence length 87
Comment hypothetical protein PSJM300_01920 [Pseudomonas stutzeri DSM 10701]
Sequence
MADNDKENAAAYWKANVRLITWSLVVWALVSYGFAILLRPMLSGIPVGGTDLGFWFAQQG
SIITFILIIFHYAWRLNKLDKEFGVEE
Download sequence
Identical sequences A0A0T6VQD8 A0A0T6VR50 A0A1C2DB37
WP_014851280.1.15675 WP_014851280.1.33310 WP_014851280.1.40133 WP_014851280.1.85814 gi|397685503|ref|YP_006522822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]