SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397685925|ref|YP_006523244.1| from Pseudomonas stutzeri DSM 10701

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397685925|ref|YP_006523244.1|
Domain Number 1 Region: 13-277
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 6.59e-96
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000348
Further Details:      
 
Domain Number 2 Region: 281-397
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 1.35e-32
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000906
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397685925|ref|YP_006523244.1|
Sequence length 403
Comment ubiquinol--cytochrome c reductase, cytochrome b [Pseudomonas stutzeri DSM 10701]
Sequence
MSKFMEWVDARFPATKMWEDHLSKYYAPKNFNVLYFFGSLALLVLVNQILTGIWLTMSFE
PSAEGAFASVEYIMRDVEYGWILRYLHSTGASAFFVVVYLHMFRGILYGSYQKPRELVWI
FGMMIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGGDLTQWIRGDYLISGIT
LNRFFALHVIALPIVILGLVVLHILALHEVGSNNPLGVDIKKTKDEAGVPLDGIPFHPYY
TVKDIVGVVVFLFVFCAVVFFFPEMGGYFLEKPNFEEANALKTPEHIAPVWYFTPYYAIL
RAVPDKLLGVIAMGGAIAVLFVLPWLDRSPVKSMRYKGWMSKVALVVFCISFIILGVLGV
LSPTPERTLVSRICTAIYFGYFILMPFYTKIEKTKVVPQRVDG
Download sequence
Identical sequences A0A0T6VAE5
WP_014851699.1.15675 WP_014851699.1.33310 gi|397685925|ref|YP_006523244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]