SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397686376|ref|YP_006523695.1| from Pseudomonas stutzeri DSM 10701

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397686376|ref|YP_006523695.1|
Domain Number 1 Region: 3-129
Classification Level Classification E-value
Superfamily FlgN-like 6.41e-26
Family FlgN-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397686376|ref|YP_006523695.1|
Sequence length 156
Comment FlgN family protein [Pseudomonas stutzeri DSM 10701]
Sequence
MQDTALLQQFIDDIGIAEQLLELTNREYQTLSERNLVELEKLLTQKQSLLALLGQHATLR
SQALAARQLSADRSGLEAFCATSPSGTDILEQAGKLEKLLADCRTANERNGQLIRTNQAA
VGSMLNILQGSNQAPNLYDRRGGAAKTSHQRPLSQA
Download sequence
Identical sequences A0A0T6VVE7 A0A1C2DXJ0
gi|397686376|ref|YP_006523695.1| WP_014852146.1.15675 WP_014852146.1.40133 WP_014852146.1.85814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]