SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397688718|ref|YP_006526037.1| from Pseudomonas stutzeri DSM 10701

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|397688718|ref|YP_006526037.1|
Domain Number - Region: 3-39
Classification Level Classification E-value
Superfamily FlgN-like 0.0262
Family FlgN-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397688718|ref|YP_006526037.1|
Sequence length 69
Comment chromosome segregation ATPase [Pseudomonas stutzeri DSM 10701]
Sequence
MDDADLQLLTHKLEQLIQRIEQLKAQNGLLLANEQAWREERAHLIEKNELARVKVEAMIS
RLKALEQDS
Download sequence
Identical sequences A0A0T6VBA8 A0A1C2DTQ0
WP_014854463.1.15675 WP_014854463.1.40133 WP_014854463.1.85814 gi|397688718|ref|YP_006526037.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]