SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397685648|ref|YP_006522967.1| from Pseudomonas stutzeri DSM 10701

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397685648|ref|YP_006522967.1|
Domain Number 1 Region: 90-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.13e-67
Family RecA protein-like (ATPase-domain) 0.00000000959
Further Details:      
 
Domain Number 2 Region: 49-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.23e-29
Family Cold shock DNA-binding domain-like 0.0000198
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00000000000286
Family Rho termination factor, N-terminal domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397685648|ref|YP_006522967.1|
Sequence length 419
Comment transcription termination factor Rho [Pseudomonas stutzeri DSM 10701]
Sequence
MNLTELKQKPITELLEMAEQMGIDNMARSRKQDVIFSLLKKHAKSGEEISGDGVLEILQD
GFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDSIVGKIRPPKEGERYFALLKVDSIN
YDRPENAKNKILFENLTPLFPNERLKMEAGNGSTEDLTGRVIDLTAPIGKGQRGLIVAPP
KAGKTIMLQNIASNITRNNPECHLIVLLIDERPEEVTEMQRTVRGEVVASTFDEPPTRHV
QVAEMVIEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSSGKVLTGGVDAHALEKPKRF
FGAARNIEEGGSLTILATALVETGSKMDEVIYEEFKGTGNLELQLDRRIAEKRVFPAINI
NRSGTRREELLTAEDELQRIWILRKLLHPMDEIAAIEFLLDKLKDTKTNDEFFMSMKRK
Download sequence
Identical sequences A0A0T6VW58 M2VIZ1
WP_003301061.1.15675 WP_003301061.1.33310 WP_003301061.1.86065 gi|397685648|ref|YP_006522967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]