SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397686067|ref|YP_006523386.1| from Pseudomonas stutzeri DSM 10701

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397686067|ref|YP_006523386.1|
Domain Number 1 Region: 3-254,355-447
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.56e-74
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.000000397
Further Details:      
 
Domain Number 2 Region: 237-352
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.39e-42
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00000172
Further Details:      
 
Domain Number 3 Region: 424-525
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 1.96e-31
Family Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397686067|ref|YP_006523386.1|
Sequence length 537
Comment L-aspartate oxidase [Pseudomonas stutzeri DSM 10701]
Sequence
MSQHHQYDVLVIGSGAAGLTLALNLPESLRIGVLSKGDLANGSTYWAQGGVAAVLDDTDT
VESHVADTLIAGGGLCNEEAVRFTVEHSREAIQWLIEQGVPFTREEADRESGSFEYHLTR
EGGHSHRRIIHAADATGAAIFNTLLARTQKRSNIDLLHQRVAVDLITERKLGLPGKRCLG
AYVLDRSTGEVDTFQAKFVVLATGGAAKVYLYTSNPDGACGDGIAMAWRAGCRVGNLEFN
QFHPTCLYHPQAKSFLITEALRGEGALLKLPNGERFMPRFDERAELAPRDIVARAIDHEM
KRLGIDCVYLDISHKPAEFIKAHFPTVHERCLQFGIDILREPIPVVPAAHYTCGGVVVDG
AGRTDIPGLYAIGETSFTGLHGANRMASNSLLECFVYARSAARDILRELPEIDGPTNLPQ
WDASQVTNSDEDVIIAHNWDELRRFMWDYVGIVRTDKRLTRAQHRVRLLLDEIDEFYSNY
KVSRDLIELRNLATVADLMIRSAMQRKESRGLHYTLDYPDLLPEALDTILAPPTYRD
Download sequence
Identical sequences WP_014851840.1.15675 gi|397686067|ref|YP_006523386.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]