SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397687246|ref|YP_006524565.1| from Pseudomonas stutzeri DSM 10701

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397687246|ref|YP_006524565.1|
Domain Number 1 Region: 360-380,419-668
Classification Level Classification E-value
Superfamily HAD-like 9.9e-56
Family Meta-cation ATPase, catalytic domain P 0.00042
Further Details:      
 
Domain Number 2 Region: 163-260
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 3.14e-25
Family Calcium ATPase, transduction domain A 0.0024
Further Details:      
 
Domain Number 3 Region: 127-163,261-356
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000000432
Family Calcium ATPase, transmembrane domain M 0.015
Further Details:      
 
Weak hits

Sequence:  gi|397687246|ref|YP_006524565.1|
Domain Number - Region: 73-108
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0341
Family beta-Galactosidase/glucuronidase domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397687246|ref|YP_006524565.1|
Sequence length 676
Comment heavy metal translocating P-type ATPase [Pseudomonas stutzeri DSM 10701]
Sequence
MALEPVIPELDEEENPELKDFSRRFWWTLPLTVIVTVLAMGGHSLNLFHGTTQNWVELVL
TTPVVLWAGWPFFERCVRSFVLRSPNMWTLIGLGTAAAYLYSVVATLAPGVFPADFVQDG
RIGVYFEAAAVIISLTLLGQLLELKARSQTSAAIKSLLGLAPKTARRINPDGTEDDIPLT
HVHAGDRLRVRPGEKVPVDGLVLEGESAVDESMLTGEPVPIMKHVGDSLIGATLNAHGSL
VMQAQKVGSSTMLAQIVQMVAQAQRSKAPMQRLADVIAGYFVMVVIAIAILTFLVWGLWG
PEPSWVFGLINAVAVLIIACPCALGLATPMSVMVTTGKAAGSGVLFRDAGAIENLRKIDT
LIVDKTGTLTEGRPAFHSVEAAPGFTPDEVLRLAASLDQGSEHPLAHAIVDHARAHGLAL
STAETFESASGIGVRGQVDDHHLQLGNTALMNDAGVDASSLSARAEQLRGEGVSIMFLAV
DGVLAGLLAVADPIKPTSKLAVERLQADGVRVIMATGDGLTTARAVARELGIEEVHGEVK
PQDKERLAAALQQEGHRVAMAGDGINDAPALARADIGIAMGTGTDVAMNSAQVTLVKGDL
LGILRARSLSVATVRNMHQNLTFAFLYNALGIPLAAGLLYPLTGLLLSPIIAALAMSLSS
ASVVFNALRLRKVSID
Download sequence
Identical sequences gi|397687246|ref|YP_006524565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]