SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397687508|ref|YP_006524827.1| from Pseudomonas stutzeri DSM 10701

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397687508|ref|YP_006524827.1|
Domain Number 1 Region: 506-526,558-794
Classification Level Classification E-value
Superfamily HAD-like 1.03e-50
Family Meta-cation ATPase, catalytic domain P 0.0039
Further Details:      
 
Domain Number 2 Region: 320-409
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.18e-23
Family Calcium ATPase, transduction domain A 0.0052
Further Details:      
 
Domain Number 3 Region: 88-165
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 6.81e-17
Family HMA, heavy metal-associated domain 0.0019
Further Details:      
 
Domain Number 4 Region: 276-309,411-502
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000405
Family Calcium ATPase, transmembrane domain M 0.019
Further Details:      
 
Weak hits

Sequence:  gi|397687508|ref|YP_006524827.1|
Domain Number - Region: 162-270
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000327
Family Glycerol-3-phosphate transporter 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397687508|ref|YP_006524827.1|
Sequence length 811
Comment cation-transporting P-type ATPase [Pseudomonas stutzeri DSM 10701]
Sequence
MANPVPCYHCGLPVPAGSQFNARVLNETRALCCPGCQAVAEAIVMGGLESYYLHRSDPAT
NPEALPQALTEELELYDREEVQQPFVTHEGSLASTSLMIEGISCAACGWLIERHVRNLDG
VAEASLNLSNHRLQVRWSDARLPLSELLAELRRIGYAAHPYQPDEAAERLAQENRRAMRQ
LGVTGLLWMQVMMATMATWPEFNLDLSESFFVTLRWTALVLTTPIVFYCCTDFFRGALRD
LRTRHLTMDVSVSLAIGGAYLAGIWSTITGQGELYFDAVGMFALFLLAGRFLERRARERT
AAATAQLINLLPASCLKLGEDGQSVRILLSELRIGDQVLVQPGALIPADGRISTGQSSID
ESVLTGEYLPQARSVGDLVTAGTLNVEGPLTIQVQALGDDTRLSAIVRLLERAQSEKPRL
AELADRVAQWFLLIVLATAAIVGLVWWQIDPQRAFWIVLALLVATCPCALSLATPTALTT
ATGSLHKLGLLLTRGHVLEGLNHIDTVIFDKTGTLTEGRLTLNAVHPLAELDADTCLALA
AALENRSEHPIARAFGRAPQAADFVDSVPGLGLQGAVAGRSLRIGHPRFVAEGYLGSAPK
IPDDQGQWLLLGDERGPLAWLVLDDRLRADAPALLDACRQRGWNTFLLSGDSSPMVGRIA
EQLGFDEALGGLTPADKLAHLQRLQADGRRVLMLGDGVNDVPVLAAADISVAMGSATDLA
KTSADAVLLSNRLDSLVQAFDVARRSRRIIVENLAWATLYNGLILPFAAIGWVTPLWAAI
GMSASSLLVVLNALRLTRLPSAATQSPRRAA
Download sequence
Identical sequences gi|397687508|ref|YP_006524827.1| WP_014853267.1.15675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]