SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212633682|ref|YP_002310207.1| from Shewanella piezotolerans WP3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212633682|ref|YP_002310207.1|
Domain Number 1 Region: 552-1039
Classification Level Classification E-value
Superfamily ALDH-like 1.18e-130
Family ALDH-like 0.000000394
Further Details:      
 
Domain Number 2 Region: 192-536
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 9.81e-108
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000506
Further Details:      
 
Domain Number 3 Region: 17-191
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 1.29e-64
Family N-terminal domain of bifunctional PutA protein 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|212633682|ref|YP_002310207.1|
Sequence length 1059
Comment Delta-1-pyrroline-5-carboxylate dehydrogenase 3 [Shewanella piezotolerans WP3]
Sequence
MFKASEVLAGHYDSADLNELFKAISDNYIVDEEQYLSELIKLVPSSDEEIDRVTNRAHEL
VNKVRQYDKKGLMVGIDAFLQQYSLETQEGIILMCLAEALLRIPDSATADALIEDKLSGA
KWDEHISKSDSVLVNASTWGLMLTGKIVKLDQKTDGRPSNLLNRLVNKMGEPVIRQAMLA
AMKIMGKQFVLGRSVKEALKNSVDKRKLGYTHSYDMLGEAALTKKDAAKYFDDYSSAIAA
LGAQEYDESEAPRPTISIKLSALHPRYEVANEDRTLTELHDTLILLIKQARSLNVGVSID
AEEMDRLELSLQLFQRLYNSEAAKGWGLLGIVVQAYSKRALPVLCWLTRLAKIQGDEIPL
RLVKGAYWDSELKWSQENGEAGYPLYTRKAGTDVSYLACARYLLSDSTRGAIYPQFASHN
AQTVASITAMAGDRNYEFQRLHGMGEELYDTLLAESGVKTVRIYAPVGAHKDLLPYLVRR
LLENGANTSFVHKLVDPNTPIESLVVHPLSTLKGYKTLANNKIVLPEDIFGAERKNSKGL
NMNIISESTPFFAAIEKFKETTWSAGPLVNGETLSGETNEIVSPFDTTKVVGKVAFANNQ
AIEQALAGADASFSSWCSTPVEVRANALQKLADLLEENREELIALCTREAGKSIQDGIDE
VREAVDFCRYYAVQAKKMMGQPELLPGPTGELNELFLQGRGIFVCISPWNFPLAIFLGQV
AAALAAGNTVVAKPAEQTSIVGYRAVQLAHEAGIPKEVLQFLPGTGATVGSAITSDERIG
GVCFTGSTGTAKLINRTLAMREGAIIPLIAETGGQNAMVVDSTSQPEQVVTDVVASSFTS
AGQRCSALRVLFLQEDVAERVLDVMKGAMEELTIGDPSSVKTDVGPVIDATAAANLNAHI
DHIKQVGTLLKQIELPAGTENGHFVTPTAVEIDSIKVLEKEHFGPILHVIRYKASELNKV
IDEINSTGFGLTLGIHSRNEGHALEVADKVNVGNVYINRNQIGAVVGVQPFGGQGLSGTG
PKAGGPHYLTRFVTEKTRTNNITAIGGNATLLSLGDSED
Download sequence
Identical sequences B8CIZ4
WP_020910999.1.101980 gi|212633682|ref|YP_002310207.1| 225849.swp_0809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]