SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212633815|ref|YP_002310340.1| from Shewanella piezotolerans WP3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212633815|ref|YP_002310340.1|
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.92e-23
Family Methylenetetrahydrofolate reductase 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|212633815|ref|YP_002310340.1|
Sequence length 324
Comment hypothetical protein swp_0949 [Shewanella piezotolerans WP3]
Sequence
MKKSLKQRSSDHHRGIYFIGTTPPKIDTDFESVSTIADKLLARLDEISFDGLIIYDIQDE
TSRIDTPRPFPFKATYDSGTYAQLLNQKSAKPVIAYKSVAGLDEQSFNEWLSRAWYQNNV
RDLVLVGSPSTQATSSLPLNDAYRVLAEHSREFYLGGVAIAERHLSKKNEHIRLLGKSTL
GCEYYITQAVYNAQATIDMLTSYAEECALNNIKPNRVILTFSPCGSAKTLEFINWLGVSV
PEATRERILSADDPLYESIKVNHSNLLKILAAVLPLNIPLGLNIESLTNRKTEIDASILM
YKLLKGTMNQALAQNQIDQFVLNR
Download sequence
Identical sequences B8CK50
WP_020911131.1.101980 225849.swp_0949 gi|212633815|ref|YP_002310340.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]