SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212634982|ref|YP_002311507.1| from Shewanella piezotolerans WP3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212634982|ref|YP_002311507.1|
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.49e-21
Family Anti-sigma factor antagonist SpoIIaa 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|212634982|ref|YP_002311507.1|
Sequence length 110
Comment Antisigma-factor antagonist (STAS) domain protein [Shewanella piezotolerans WP3]
Sequence
MQFDIIEKGQYTIVQINEGRFDAKLAPAFREQLEQIKGNIREHLVLDLGEVRFMDSSGLG
AVMGAYKMLRNTKISIVNPQKPVTDLLKLTRMDKLILSHPTIEDALAPTA
Download sequence
Identical sequences B8CLZ6
225849.swp_2169 gi|212634982|ref|YP_002311507.1| WP_020912282.1.101980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]