SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1140198|estExt_Genewise1.C_5_t10280 from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi3|1140198|estExt_Genewise1.C_5_t10280
Domain Number 1 Region: 7-165
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 1.31e-43
Family Peptidyl-tRNA hydrolase-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1140198|estExt_Genewise1.C_5_t10280
Sequence length 187
Sequence
MLRGASHWLVVGLGNLPYPGTRHSVGHLVLDSLASRFGVSFASDSSVKGFKATKHHALGH
SDVTVTLYKPKALMNISGPPVATALKTLSIPPSHMIVVHDSLDHKPMKVSAKWGGSASGH
NGVRSIIASLGGTKDFHRLRIGIGRDQSDPADYVLRHLSPEERDFWLNGDGVHAVWSALV
KSMATSP
Download sequence
Identical sequences S8EMJ0
jgi|Fompi1|158163|estExt_fgenesh1_kg.C_10116 jgi|Fompi3|1140198|estExt_Genewise1.C_5_t10280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]