SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1169642|estExt_Genewise1Plus.C_1090028 from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi3|1169642|estExt_Genewise1Plus.C_1090028
Domain Number 1 Region: 35-245
Classification Level Classification E-value
Superfamily ITPase-like 1.44e-40
Family Maf-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1169642|estExt_Genewise1Plus.C_1090028
Sequence length 258
Sequence
MFGFLSSNEKIALPDHNCVLPHALQLPALKKLVGKRVILASASPRRKEILQTFGLSPEIV
PSTFEETLPLSSFEDIHEYPVATATHKAVEVYQKLVRENPDDAPDLVIGADTVVLTHPAP
GLSSMPPDVPFGSQDLLEKPLDKADNYRMLLDLNGGISEVVTGVSVVYPVLEAPGYKIKS
IDERTLVYFADNPTELLEAYVNSGEGLDRAGGFAVQGLGGMLVRKVDGDYQNVVGFPAAS
FFKFLDLLIEEEEDFLEV
Download sequence
Identical sequences S8DPE6
jgi|Fompi1|150028|estExt_fgenesh1_pm.C_160015 jgi|Fompi3|1169642|estExt_Genewise1Plus.C_1090028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]