SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1053547|gm1.9227_g from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi3|1053547|gm1.9227_g
Domain Number 1 Region: 300-541
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000981
Family Tropomyosin 0.0027
Further Details:      
 
Domain Number 2 Region: 495-708
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000262
Family Tropomyosin 0.0057
Further Details:      
 
Weak hits

Sequence:  jgi|Fompi3|1053547|gm1.9227_g
Domain Number - Region: 1253-1354
Classification Level Classification E-value
Superfamily Tropomyosin 0.00085
Family Tropomyosin 0.0094
Further Details:      
 
Domain Number - Region: 783-992
Classification Level Classification E-value
Superfamily Tropomyosin 0.00229
Family Tropomyosin 0.013
Further Details:      
 
Domain Number - Region: 1024-1129
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0123
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1053547|gm1.9227_g
Sequence length 1592
Sequence
MPTRRRLQLYQVLVSLIATGYTLANPPRCVEEHLRSLEALDNLVLYYFVLGGYASLVFYF
FHWGMSSLVTPRTLGHFRTLLTAFNVPLLRYAIDEYFNSHLNLQYRDHLIETMLDRELRD
AQHTRTIATLQQHNDSLNTQLDTAHDKHRNALNALREHKFKLNGQKATAKDLRIRLKEQQ
ALVNARNARVVELETDAANLNTNVADLRTQLDATEADAVKHETSATEWQARALKEGAKAE
KLKVKLERKREDRDAWMDRALSSAEKAREFQDLASHNAKVARGYCERIERQEELNRKAGD
KISAYRYRVREAEAKVDDLETRTVELEGWNEKWRARADAEEAKAGRLASELDEWKQRAQQ
LEDTVAEWKARSTMQEAEASDLEARNVKFEATVADLQDEISDLETRATGFEATAADWESQ
ARHHENDATEWKARATEEGNKVSGLNASNLALQATVADYETKVKSLNNDVTELAAKAADW
ASKARDYENEAVEWKTRATERQAKADVLETRKGELEAEVGELKSGIAEHDLRALALVAEV
DEVKAVSRNHENASVEWKARATEQQTRADDLEARTRELETTLGNVNARLTERDTLVATLT
TRGSELEATVRDADARVLELDALVNTWQTRAEANEIIADERETRATELESEIKSLNTHKD
ELESRAVNLETRASEAEATAADWEARAESEAAKVVDLEGRILDLEERVISSDFEMLGSKE
DADEWKACAHEHEIRADNLDGRIAELVSDIGERDTRICDLEATVQDRDAGIIATKLATDE
WKAHALKSEARISHAEGRVRGAEIMAHKLESDLAASHQVVAVFIDRFLQGRGAIADLRRH
NASMSETHEELKARAAALEASAADWAARAESEVAKVIVLEGRILDLEERVISSEFEMLGS
KEDADEWEADAHEHKARADNLDGRIAELVSDVNARDTRICDLEAAAQDRDANIAAIKLAA
KEWKAHALESNIHAEGRVRDAEITARELEADLAASHQVVAIFIDRFLQGRGAIADLTRRN
ASVSETHKELKARSVVLERDAQKSQVEFVRTQAALDDQREVNNALKSEVAAFATERLTWK
TKLAASEAQGKGIEAQLSEVRKELAAEKDGSTWLSSEVSSLSHRLHSAQGDLRASTTQIE
GAKAELSRTVKELDAQKKAKVDLDNARNALQTKQIATPVRVQALKAQPSTSRSTPASPQP
HGTPSKVRNVPANKPATPKALTPGAKSTLTRTAGLRENQNIANTDSTRANDALKAELAAS
KKDLGTLESQLAASEERVEDLQAQLATSGGELDGVKAKLAEAETTWATHKCDSEAIAAME
RVQVAEQELTETQVRLGDSEATVVRLSQRVTDVELEHAMHKCQPLALEDKTIDEGAQAIA
ASPVASDALAVQGLIVALAHLRKQCKAEAEAKEKLAAEQTIARTLSRVAHHALDYSDEQV
DAMRAERAAVYRQMQLERYKRDVEESKVDELTARNHELTWALRKVEQYLRDEGLYNSEDE
FEDELEDDSVEADKDDFMEGDEDDLVEGDSMEVNEGNSVEGEGDSAQAVDDSNSPEEADS
DTNKATEDDPKEADEDVTTRATQPVESPATTV
Download sequence
Identical sequences S8F2R8
jgi|Fompi3|1053547|gm1.9227_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]