SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Fompi3|1166239|estExt_Genewise1Plus.C_520128 from Fomitopsis pinicola FP-58527 SS1 v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fompi3|1166239|estExt_Genewise1Plus.C_520128
Domain Number 1 Region: 3-371
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.59e-99
Family IF2B-like 0.000000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fompi3|1166239|estExt_Genewise1Plus.C_520128
Sequence length 385
Sequence
MTLTSIKTSGDKIEIINQLLLPHTTEFIEIDTIEQAYDAIKSMRIRGAPAIASLAALTIA
SHLSRALHSQTPPDWLSSPELLSAYVTPKLNYLYTARPTAVNLGAAMRRLKNRLRTAREE
GKDARAIAQDLVDEGREIDAEDVARNKTMSKWGGDWLVDQVKAKGKDPEGLNVMTVCNTG
SLATSGYGTALGLITYLHETKKLSRAFFTQSTPYHQGSRLTALELLTLNIPATMLCDSMV
GSLFQHHDIHAVVVGADRIARNGDTANKVGTYNAAVLAARHNIPFIVVAPISTVDLDIAD
GSAIPIEQRPPIEARLVRGAVYPFTLNGQGVKEQATVMVTPENLESVYNPSFDVTPAELI
SAIVTEKGVAVKADGENAFDLSSVV
Download sequence
Identical sequences S8DYY0
jgi|Fompi1|132060|estExt_Genewise1Plus.C_1_t30074 jgi|Fompi3|1166239|estExt_Genewise1Plus.C_520128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]