SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212223756|ref|YP_002306992.1| from Thermococcus onnurineus NA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212223756|ref|YP_002306992.1|
Domain Number 1 Region: 195-362
Classification Level Classification E-value
Superfamily RibA-like 7.85e-58
Family RibA-like 0.00000496
Further Details:      
 
Domain Number 2 Region: 5-187
Classification Level Classification E-value
Superfamily YrdC/RibB 1.35e-44
Family 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|212223756|ref|YP_002306992.1|
Sequence length 388
Comment bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein [Thermococcus onnurineus NA1]
Sequence
MKPDWESIRRAIIDGKPAVLVDNRREFEADLVYPAELANSEVVNFMLSMKGLLCLTIDLE
QALKRGFFPLPSKGGETNFLIPVDYEETFTGITAEERALTARKIAEGLEVEHFRYPGHLH
LLGGVGLNWRRGHTESSLELMEILGFKRYALIVEILNGEGDSHDHDYVLKFAKEHDLPVL
TTDDVWREFVRRKQLVSVYANARLPTRYGEFRIISFENELDFKEHVAIVKEPYSEVPLVR
IHSKCLTGDTLASLKCDCGSQLSNVLRMIAQEGGILLYMDQEGRGIGLKEKIKAYELQDK
GLDTVQANEALGHKGDERTYEAAFQMLRALGVSKVRLITNNPTKARALEELGIEVVEMIP
APGEVTEHNRPYLRIKAEKLGHKLPFEV
Download sequence
Identical sequences B6YUQ9
gi|212223756|ref|YP_002306992.1| WP_012571567.1.24713 523850.TON_0608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]