SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212223320|ref|YP_002306556.1| from Thermococcus onnurineus NA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212223320|ref|YP_002306556.1|
Domain Number 1 Region: 34-321
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.22e-78
Family Phosphate binding protein-like 0.00000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|212223320|ref|YP_002306556.1|
Sequence length 329
Comment TRAP-type transporter [Thermococcus onnurineus NA1]
Sequence
MKKVMSIGLVAVLVLAVVIAGCIGSEGGQTTQTQEITIYTGGTSGVYFPLGSKYAEILSK
NGVNAKAVTSGASVANAKAIGDGTAQAAIMQNDVAYYAYHGLYMFEGNKIEKLRGVAALY
PETVQFVVRADSDIKSLQDLAGKKVAIGAPGSGTAVAAEQILKAAGVWDSIQKVNQAFSE
ASQSLKLGQVDAAVIVSGAPTPAVNQIAVQTPVRILPIPDDILNKLKDEGYIFYVRQVLP
KDTYNGMTEDTPTVAVKAVLVVSADLPEDVVYQMTKILFDNVAELQKVHAKTQYISLETA
LDGMSIPLHPGAAKYYEENGMTIPSELKP
Download sequence
Identical sequences B6YSX2
WP_012571132.1.24713 523850.TON_0174 gi|212223320|ref|YP_002306556.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]