SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212224112|ref|YP_002307348.1| from Thermococcus onnurineus NA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212224112|ref|YP_002307348.1|
Domain Number 1 Region: 24-332
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.34e-81
Family Phosphate binding protein-like 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|212224112|ref|YP_002307348.1|
Sequence length 380
Comment thiamin-binding periplasmic protein [Thermococcus onnurineus NA1]
Sequence
MRKLGIALLVVLLVGLFAVPKPAAAQEELTVYSYDSIEWWMKEIVPIFEEKYGVKVNLVL
IGDAGEVLNRLILEKDSPQADVVVGIDNSYLAKAIDAGVLEPYKPENADVIPDWIIEKFD
PTFHLTPYDYGYIAINYRKDMVQNPPTSLEDLIKPEWKGKLIIEDPRTSSPGMAFLLWTI
AVYGDDWLYYWEKLKENDVQIVEGWSAAWGAFTKGEYPLVLSYATSPAATVYYENNTNIG
AVAFKEGNYLQIEGAGIVKGAKHPELAKKFIEFLISEEAQEKLPVNQWMYPVNKNVQLPE
VFQYAVEVDKPVTVDPAEIEKNYEAWLKQWTELMVEGKSADEILGKTTTETSGETDNAGI
CGPALIVGLAIVPLLLRRRR
Download sequence
Identical sequences B6YWI8
523850.TON_0963 WP_012571923.1.24713 gi|212224112|ref|YP_002307348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]