SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212224645|ref|YP_002307881.1| from Thermococcus onnurineus NA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212224645|ref|YP_002307881.1|
Domain Number 1 Region: 3-308
Classification Level Classification E-value
Superfamily Folate-binding domain 5.18e-94
Family Aminomethyltransferase folate-binding domain 0.0000000000958
Further Details:      
 
Domain Number 2 Region: 300-392
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 5.23e-26
Family Aminomethyltransferase beta-barrel domain 0.00000995
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|212224645|ref|YP_002307881.1|
Sequence length 398
Comment glycine cleavage system aminomethyltransferase T [Thermococcus onnurineus NA1]
Sequence
MAKRVHIFDWHKKNAKKVEEFAGWEMPIWYSSIKDEHLAVRNGVAIFDVSHMGEFIFKGK
DALEFLQYVTTNDISKPPAISGTYTLVLNERGAVKDETLVFNMGNDTYMMVCDSDAFEKL
EAWFNAIKRGIEKFGELDLEIENKTYDMAMFSIQGPKARDLAKDLFDIDINDLWWFQAKE
VELDGIKMLLSRSGYTGENGFEVYFEDANPYHPDPERRGEPEKALHVWKTILEAGEKYGI
KPAGLGARDTLRLEAGYTLYGNETKELQLLSTDIDEVTPLQANLDFAIFWDKEFIGKEAL
LKQRERGIPRKLVHFKMIDKGIPREGYKVYANGELIGEVTSGTSSPLLGIGIGIAFVKTE
YAKPGVEIEVEIRGKPKKAVTVAPPFYDPKKYGAFREE
Download sequence
Identical sequences B6YY21
gi|212224645|ref|YP_002307881.1| WP_012572456.1.24713 523850.TON_1494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]