SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212550630|ref|YP_002308947.1| from Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212550630|ref|YP_002308947.1|
Domain Number 1 Region: 119-279
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.37e-35
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00048
Further Details:      
 
Domain Number 2 Region: 401-560
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 6.54e-28
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0005
Further Details:      
 
Domain Number 3 Region: 7-117
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.36e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.016
Further Details:      
 
Domain Number 4 Region: 721-785
Classification Level Classification E-value
Superfamily SirA-like 0.0000000000000445
Family SirA-like 0.0012
Further Details:      
 
Domain Number 5 Region: 307-389
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.00000000113
Family Duplicated SiR/NiR-like domains 1 and 3 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|212550630|ref|YP_002308947.1|
Sequence length 786
Comment ferredoxin-nitrite reductase [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2]
Sequence
MMYRLPDTLSEDIQRFGVLSVDYREKKIGSVEFKSFRVPMGVYEQRENEVYMSRIRTTGG
VIYPKQFLRIIDIALRHHSDLLHITTRQEIQIQNLKLEEIQPIFYELQEIGLTTKGGGGN
TIRNILVSYNSGITNDEVFDTTPYAIELTTRLIAESDSYLLPRKMKIAFSSSDKQVDYAA
INDLGFVAKIQDGQKGFGVYVGGGAGSKPAVGWLVFNFIPESELFIVSEAVKKMFSEHGN
RKNRNRARIRYIFYNLGEIETIRLIREYYETLKKTIPLFLLKEEHKEKLAIEYSKSDPSN
DIVLLDENYEIWKKRYVIEQRQIGYMSVLLPFALGNLLLKNKKFIENLKKLLNFVSQFGQ
DTIRFTTTQNVQLRNIPGSALPELYLLIKNILPEVQEPLLVNNIISCTGADTCRLGICLS
KGLTVAISDKIKNTRAEWDKLATVRIHISGCPNSCGQQLWADIGFSGKALRNNRLYPGYQ
VYLASNRSDNPRLAELVGSIAARDIPEYVVRLLISYLEVRLKYKNLTSYLENEGKETAIR
LLNDYQKIPSFEDDKSYYFDWGASIPFNIINRKKTECSSGLFDMINVDLNHINDAKKNIE
TEKDEQKINKYLYDIIYFSSHMLLITRGVEPKTTEDVFNLFLQYFLDKKLVENKYYGLLE
QARDNKQSNFVIHKGNIYSLSDAVVELYRNMDDSLHFKNVELVVSEMEKIKEVSYKNRFK
DLRGVICPMNFVQVKIQLASMQSGEKLEIWLDDSHLSVIISIQNEGHQILEQDRIENYWK
VIIKKK
Download sequence
Identical sequences B6YQR4
gi|212550630|ref|YP_002308947.1| 511995.CFPG_273 WP_012573297.1.38342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]