SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212550741|ref|YP_002309058.1| from Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212550741|ref|YP_002309058.1|
Domain Number 1 Region: 270-568
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.53e-79
Family DNA repair protein MutS, domain III 0.00000462
Further Details:      
 
Domain Number 2 Region: 570-805
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.09e-55
Family ABC transporter ATPase domain-like 0.000002
Further Details:      
 
Domain Number 3 Region: 9-115
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 2.22e-37
Family DNA repair protein MutS, domain I 0.0000416
Further Details:      
 
Domain Number 4 Region: 116-269
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 4.97e-37
Family DNA repair protein MutS, domain II 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|212550741|ref|YP_002309058.1|
Sequence length 883
Comment DNA mismatch repair protein MutS [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2]
Sequence
MSIPKGIVKTPLMEQYFEIKSKYPDTILLFRVGDFYETFADDAIAASEILDIVLTHRANG
CCQTVKLAGFPYHALDTYLPKLVRAGKRIAICDQLEDPKTTKRIVKRGVTELITPGVSIN
DSILSHKENNFLAAVHFDKNICGTAFLDISTGEFLTTEGSSSYIDKLFNHFSPKEVLLER
NKREIFKKNFGEKLLTFEMEDWVFTEDTAECRLHKQFETKNLKGFGIQHLPNGIIAAGAI
LHYLDLTQHAYTNHIFTLTRIEEEQYVRLDKFTIHSLELLNVMNEGGGQSLLKVLDKTVT
SVGARMLRKWIVFPLKKIEQIEGRLSIVEYFLKSSTVKDLLEKQLNQISDLERLISKVSV
GKANPYEVAQIKIALDAIIPIKEICLDCSIGSLKQIGEQLNLCSEIREKIQRELSADPPV
LLSKGNVIAEGINGELDELRQIVYSGKDHLLKIQQREIFQTGIPSLKVGYNNVFGYYIEV
RHSYKKKIPSNWIRKQTLVHAERYITEELKIYEEKILGAEDRIIEMETDIFNSLVSKLSK
YIIPIQINARLIAEIDCLLSFAKIAEQNHYVRPQIDASRIIDIKKGRHPVIETQLQPDEL
YVPNDIYLDNDKQQIIIITGPNMAGKSALLRQTALITLMAQIGSFVPADSARIGWVDKIF
ARVGASDNISLGESTFMVEMSEAADILNNLSDRSLIIFDELGRGTSTYDGISIAWAIVEY
IHEHPTSHPKTLFSTHYHELNEMEKYFERIKNYNISVKEIDNKVIFLRKLARGGSKHSFG
IHVAKMAGIPKNVVQRGHEILFQLETNNQKKGIVPSTKQLLEDHNSYQLSFFQLDDPVLS
QIRNDIVQLDINNLTPIEALNKLNDIKRVIKGDNKASGIFIEN
Download sequence
Identical sequences B6YR25
gi|212550741|ref|YP_002309058.1| 511995.CFPG_384 WP_012573408.1.38342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]