SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|212550361|ref|YP_002308678.1| from Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|212550361|ref|YP_002308678.1|
Domain Number 1 Region: 3-209
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.85e-52
Family PP-loop ATPase 0.00013
Further Details:      
 
Domain Number 2 Region: 359-441
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000445
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|212550361|ref|YP_002308678.1|
Sequence length 447
Comment tRNA(Ile)-lysidine synthase [Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2]
Sequence
MNDVLIKKVAQYIHKNGLLPQCQAKIVVGVSGGVDSSVLLYILHHLGYKCQAAHCNFHLR
GDESCRDEKHAALLASSMNLVFFKKDFNTQYLAQRNKISIEMAARVLRYKWFEYLRQEQN
AEVIAVAHHKGDNIETLLLNLVRGTGIRGLKGIRPKHGKIIRPLLDITRQEIVQFAKDNR
IVYVDDSSNFEEKHIRNKIRFKLLPLLKTLNPSVEQVLLHTIENLAEVIKIYDSHIEEAR
NKVFNPDIGMINIIELQKFPSPESILFEILKTYGFGRDVIYNITRAMKSLSSKEFYSLQY
ILIKDRERFLLIPREESSKNKIYEIDKDDREMIVPLPIRMRYKDIGGDNFQIKCNPNIAF
LDVKKLQFPLQLRKWERGDRFVPFGMRNFQKLSDYFNNHKFSKLEKKNTWLLCSRDDIVW
IVGKRIDNRYRVSSTTRRVIIFESLEQ
Download sequence
Identical sequences B6YPZ5
511995.CFPG_004 gi|212550361|ref|YP_002308678.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]