SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|206575595|ref|YP_002235780.1| from Klebsiella pneumoniae 342

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206575595|ref|YP_002235780.1|
Domain Number 1 Region: 8-106
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.48e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|206575595|ref|YP_002235780.1|
Sequence length 110
Comment PTS system, lactose/cellobiose specific IIA subunit [Klebsiella pneumoniae 342]
Sequence
MDFDEDSMLDTEEVVMGIIVNAGHSRSLCYEALNHAKAGDFDHASKLLEMAAEAGKEAHA
IQTKLIEEDEGMGKTTMTLVMVHAQDHLMTSILCREMITELVQIYKSKLN
Download sequence
Identical sequences B5RK56
507522.KPK_A0132 gi|206575595|ref|YP_002235780.1| WP_012540146.1.55984 WP_012540146.1.6018 gi|206575595|ref|YP_002235780.1|NC_011282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]