SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325971974|ref|YP_004248165.1| from Sphaerochaeta globus str. Buddy

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325971974|ref|YP_004248165.1|
Domain Number 1 Region: 3-191
Classification Level Classification E-value
Superfamily Formyltransferase 4.19e-46
Family Formyltransferase 0.0000332
Further Details:      
 
Domain Number 2 Region: 208-405
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 2.09e-23
Family Archaeal IMP cyclohydrolase PurO 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325971974|ref|YP_004248165.1|
Sequence length 431
Comment phosphoribosylglycinamide formyltransferase [Sphaerochaeta globosa str. Buddy]
Sequence
MIRIAVLVSGGGTNLQALLDAQEKNELSCGSIVLVVSDRQASALKRVENRGVSAVLLDRS
ALGKKAFETQLLALLVQKNIDLVVLAGFLTILSSEVIARYPKRIINIHPSLIPSFCGKGY
YGLRVHQAALERGVKISGATVHLVDEVADGGPILAQQAIDVLDDDTPDSLGQRILEQVEW
KLLPKTVASYCRCMEKSMDLEQRLSSIRYPGRGIVCGLNEQGNAIIAYFITARSLHSKNR
CLVVEGETVRTKALDESLLVDPSLIIYRAMDRQGSAVVVANGDQSDTILEGLGRGITMQA
SLASRTFEPDEPNFTPRISALFHLGTDPSYTLSILRRAGDGSCDRSYYSHSACSKGQAHL
IHTYEGDGNPLPSFQGEPPLVRIKGNAGEFADHLWSLLDKEYRVCVCVKEIDLTSNATNL
VIRQGASNGLY
Download sequence
Identical sequences F0RSS1
WP_013607820.1.37756 gi|325971974|ref|YP_004248165.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]