SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|305662561|ref|YP_003858849.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305662561|ref|YP_003858849.1|
Domain Number 1 Region: 8-222
Classification Level Classification E-value
Superfamily Triosephosphate isomerase (TIM) 1.06e-48
Family Triosephosphate isomerase (TIM) 0.000000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|305662561|ref|YP_003858849.1|
Sequence length 230
Comment triosephosphate isomerase [Ignisphaera aggregans DSM 17230]
Sequence
MKHLKVPVLAINFKAYPTSFGVKALEIAKAAEKVAQEYGVEVIVIPPATELRKIVESVSI
PVYAQHADPYEYGAYTGWLPVVALKDIGVRGILVNHSEHRLRLDEIVAIVEAAKKYGLET
LVCADTPIAAAAIAAIKPVALAVEPPELIGTGIAVSKAKPEVITNTVQRVREVNKEVIIL
TGAGISTAEDVEAAIRLGTAGVLVASAIMKAQNPEKVIKDMAAVAKAAYK
Download sequence
Identical sequences E0SPU7
gi|305662561|ref|YP_003858849.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]