SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|305663425|ref|YP_003859713.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305663425|ref|YP_003859713.1|
Domain Number 1 Region: 80-196
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 6.8e-18
Family V-type ATPase subunit E 0.0019
Further Details:      
 
Weak hits

Sequence:  gi|305663425|ref|YP_003859713.1|
Domain Number - Region: 21-51
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0222
Family F1F0 ATP synthase subunit B, membrane domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|305663425|ref|YP_003859713.1|
Sequence length 198
Comment H+transporting two-sector ATPase E subunit [Ignisphaera aggregans DSM 17230]
Sequence
MSSVEELKNIVVRRAEEEAKRIIEGAEKEAERIVREAEEKRMKLVEEAKKKVISDIGYEQ
RLAEAKANARKVIAEAKSSVLNDLRKNILRLLNDLDDARRFASLRNLIMEALQAIEISRG
KRIILRVSNKDLRFAEMLSRDIATKHSISVSVEPIEISGGVIIEDVDTGIIVDNSYEARL
RRILTINAPKIQERLFSS
Download sequence
Identical sequences E0SNN7
gi|305663425|ref|YP_003859713.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]