SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|305663607|ref|YP_003859895.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|305663607|ref|YP_003859895.1|
Domain Number - Region: 52-110
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0256
Family DNA-binding N-terminal domain of transcription activators 0.015
Further Details:      
 
Domain Number - Region: 1-33
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0445
Family Arc/Mnt-like phage repressors 0.084
Further Details:      
 
Domain Number - Region: 86-182
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 0.0772
Family V-type ATPase subunit E 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|305663607|ref|YP_003859895.1|
Sequence length 232
Comment hypothetical protein [Ignisphaera aggregans DSM 17230]
Sequence
MKTIVIRVDEKIYEELEKKAKAEGFLTVSEYIYSLTLRTLGQQIEKESEVQKKVQLSLDK
IIAILERRLQDKLNPFTSKIDDLGKRIADIIERIENLEQKIADIENQLSSTIRREREKKE
EKVTPKKTAIDILKEQKVMFERDIASRIKDRDSFFAKLQKSGAIIVEAKDERIAIENTFW
SEFVKKLENITTTNEDEIKKILDPIEYRLFSKLRESAIIVYDATLKKWVVYL
Download sequence
Identical sequences E0SP88
gi|305663607|ref|YP_003859895.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]