SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|305663682|ref|YP_003859970.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305663682|ref|YP_003859970.1|
Domain Number 1 Region: 118-252
Classification Level Classification E-value
Superfamily Translational machinery components 1.05e-34
Family ERF1/Dom34 middle domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 3.27e-34
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00043
Further Details:      
 
Domain Number 3 Region: 256-348
Classification Level Classification E-value
Superfamily L30e-like 3.6e-17
Family ERF1/Dom34 C-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|305663682|ref|YP_003859970.1|
Sequence length 351
Comment peptide chain release factor subunit 1 (aeRF-1) [Ignisphaera aggregans DSM 17230]
Sequence
MKKWKAHATTLLSLYIPPGRPISDVVSLLRQELAITENIKLKRTRDAVQWALTAAIDRLS
KIRENPKNGLVVFAGINDDTGENIAIVFSPPDPVPVYFYRTDKEFHTEFLVPMVEESDVY
GIIIIERDEATIGILKPSGIVVLDEIEWYIPGKHHKGGQSQRRFDRIIEQMVEEFYKHVA
EKVNSYFVPLIEEGKLKGVIVAGPGYAKQDFLKEADNLDYRIRKLIISETIDVAYQGIVG
LKEVVIKAKDILVKQRFVESMEAIEEFKYHIAKDDGYAVYGLKDIEELLNNGAIEKILIC
EDHPDFDRLEKIAMERGAKMIIIPESLDEYQWFKDTFGCIAAISRYAIHQS
Download sequence
Identical sequences E0SPN4
gi|305663682|ref|YP_003859970.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]