SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|305663929|ref|YP_003860217.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305663929|ref|YP_003860217.1|
Domain Number 1 Region: 10-123,227-424
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 1.31e-100
Family Substrate-binding domain of HMG-CoA reductase 0.00000021
Further Details:      
 
Domain Number 2 Region: 115-221
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 3.66e-29
Family NAD-binding domain of HMG-CoA reductase 0.0000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|305663929|ref|YP_003860217.1|
Sequence length 427
Comment hydroxymethylglutaryl-CoA reductase, degradative [Ignisphaera aggregans DSM 17230]
Sequence
MEQEGIKTSRIQGFYKLSIDERLKIVKEIANLTDEEVNLLRNFGNLDPKIADSMIENVIG
AMSYPFAVAVNFKINGKDYLVPMVIEEPSVVAAASNAARMLREGEGIRALADKQYMIGQI
HILNPKSPYTAINEILLHKEEILEAANATNNTLRKLGGGAKDIEVRIVETRRGISIIVHL
IVDVLDAMGANTVNTMAEAVAPMIERITGGEARLKIVSNYAIYRLVRAWVRVSPDAIGGR
DVAEKIVDASALAEADPFRAVTHNKGIMNGIIAVALATAQDHRAIEAGAHAYAARSGTYK
PLSRWDIDSDGYLTGFLEIPLQVGIVGGAVKTHPIARIALKILNIKSAKELAEVMAAVGL
AQNFAALRALVTEGIQRGHMKLHARNLAILAGATGELVEIVAEQMIKEGKISFDYAKELV
EKYTSHG
Download sequence
Identical sequences E0SR07
gi|305663929|ref|YP_003860217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]