SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|305664163|ref|YP_003860451.1| from Ignisphaera aggregans DSM 17230

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|305664163|ref|YP_003860451.1|
Domain Number 1 Region: 2-165
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.67e-38
Family LeuD-like 0.0000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|305664163|ref|YP_003860451.1|
Sequence length 173
Comment 3-isopropylmalate dehydratase small subunit [Ignisphaera aggregans DSM 17230]
Sequence
MKIRGKCWKLGDNISTDHIISGKYKFEAIDDISKMLPHLFEEVIPEFYKKVSPGDIIVAG
RNFGKGSSREQAPRLIKMAGISAIIAKSFAHIFYRNAINIGLPVIVLQRLSDVTESGDII
EVDLVNGYAINVSKNFQERFAPYPKEIELILLNNGIVSYIKRYGVPPWQRNIE
Download sequence
Identical sequences E0SSB4
gi|305664163|ref|YP_003860451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]